Tap / click on image to see more RealViewsTM
$71.75
per tie
 

Glitch: achievement ascended level61 tie

Qty:

    Other designs from this category

    About Ties

    Sold by

    Style: Tie

    Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

    • Dimensions:
      • Length: 139 cm
      • Width: 10.1 cm (at widest point)
    • Printed in vibrant full colour
    • Made from 100% polyester; silky finish
    • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
    • Dry clean only

    About This Design

    Glitch: achievement ascended level61 tie

    Glitch: achievement ascended level61 tie

    Glitch: achievement ascended level61 This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

    Customer Reviews

    4.5 out of 5 stars rating2.5K Total Reviews
    1852 total 5-star reviews331 total 4-star reviews143 total 3-star reviews76 total 2-star reviews127 total 1-star reviews
    2,529 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Anonymous6 April 2025Verified Purchase
    Tie
    Lovely. My English class was impressed!
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Amy C.17 May 2022Verified Purchase
    Tie
    Zazzle Reviewer Program
    It's absolutely perfect!! Turned out much better then I expected ❤️ It is a little expensive but very worth it. Printing is perfect can read it very well
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Geoff T.25 January 2021Verified Purchase
    Tie
    Zazzle Reviewer Program
    Great company, gave me a generous credit when I made an ordering mistake. Delivery of products very quick. Highly recommended. Quality of the product is excellent

    Tags

    Ties
    achievementascendedlevel61glitchglitchenwetdryvactinyspeckglitchthegame
    All Products
    achievementascendedlevel61glitchglitchenwetdryvactinyspeckglitchthegame

    Other Info

    Product ID: 151428018760803099
    Added on 7/10/14, 9:14 am
    Rating: G