Tap / click on image to see more RealViewsTM
$104.35
per cushion
 

Glitch: achievement amorphous crystallizer cushion

Qty:
40 cm Throw Pillow
+$26.50
+$54.50

About Cushions

Sold by

Size: 40 cm Throw Pillow

Accent your home with custom cushions from Zazzle and make yourself the envy of the neighbourhood. Made from high-quality Simplex knit fabric, these 100% polyester cushions are soft and wrinkle-free. The heavyweight stretch material provides beautiful colour definition for your design while also being the perfect complement to your sofa!

  • Dimensions: 40.6 cm x 40.6 cm (square)
  • Simplex knit fabric; 100% polyester; wrinkle-free
  • Hidden zip enclosure; synthetic-filled insert included
  • Machine washable
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 40.6 cm. For best results, please add 1.5 cm bleed.

About This Design

Glitch: achievement amorphous crystallizer cushion

Glitch: achievement amorphous crystallizer cushion

Glitch: achievement amorphous crystallizer This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating9.6K Total Reviews
8350 total 5-star reviews906 total 4-star reviews196 total 3-star reviews77 total 2-star reviews117 total 1-star reviews
9,646 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sharon B.30 November 2021Verified Purchase
Throw Pillow, 40 cm Throw Pillow
Zazzle Reviewer Program
How much fun is this cushion seriously fits in with the other two purchased in the same theme . Fun, seriously not boring and happy . Printing quality is excellent, the colours are true to advertised
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sharon B.30 November 2021Verified Purchase
Throw Pillow, 40 cm Throw Pillow
Zazzle Reviewer Program
Great quality but more importantly this cushion is unique and forms one of three in the Alice in Wonderland series for a daybed for the grandchildren when they stay over. Imaginative and fun. Lovely quality and colours
5.0 out of 5 stars rating
5 out of 5 stars rating
By N.22 August 2023Verified Purchase
Throw Pillow, 40 cm Throw Pillow
Zazzle Reviewer Program
OMG my order exceeded my expectation’s. My products are beautiful, they were done soo well. The cushion I did was for my nephews birthday, who had his little pet chapoodle for just over 15yrs, she passed last yr. So I had some special photos as well as a photo of her paw prints and hair put on the cushion. I wanted to make it special for him. His birthday is not until Mon 27th so he hasn’t seen it yet. When he opens his present on the his special day, we are all going to have a little cry, all because of the cushion and how well it was made to bring out the best memories we have of our little Princess. So thank you soo much for the work you did, and I will most definitely be using you again for one of my other products. Thank you thank you thank you Job well done 👍. Exceeded my expectations. Beautiful job well done 👍

Tags

Cushions
achievementamorphouscrystallizerglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementamorphouscrystallizerglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 189385826926761261
Added on 7/10/14, 9:13 am
Rating: G