Tap / click on image to see more RealViewsTM
$101.00
per case
 

Glitch: achievement amateur decrustifier Case-Mate iPhone case

Qty:
Tough
-$13.15

Other designs from this category

About Casemate Cases

Sold by

Style: Case-Mate Tough Apple iPhone 11 Case

Simple, but tough. Contoured to fit the sleek curves of the iPhone, this Case-Mate case features a hard shell plastic exterior and shock absorbing liner to protect your device.

  • Designed for the Apple iPhone 11
  • Shock absorbing flexible liner for an added layer of protection
  • Impact resistant, durable hard plastic
  • Case will not interfere with wireless charging
  • Lay-flat bezel to protect your screen from directly contacting surfaces
  • Access to all ports, controls & sensors
  • Customise with your images, designs and text
  • Glossy finish
  • Printed in the USA

About This Design

Glitch: achievement amateur decrustifier Case-Mate iPhone case

Glitch: achievement amateur decrustifier Case-Mate iPhone case

Glitch: achievement amateur decrustifier This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating6.6K Total Reviews
5268 total 5-star reviews845 total 4-star reviews211 total 3-star reviews120 total 2-star reviews127 total 1-star reviews
6,571 Reviews
Reviews for similar products
1.0 out of 5 stars rating
1 out of 5 stars rating
By Anonymous14 October 2025Verified Purchase
Case-Mate Phone Case, Apple iPhone 11, Tough
Item never came. Paid for express shipping for arrival on the 12th of September, in time for a birthday gift. 1 month later and have yet to receive item.
4.0 out of 5 stars rating
4 out of 5 stars rating
By Lynn M.22 December 2023Verified Purchase
Case-Mate Phone Case, Apple iPhone 11, Tough
Zazzle Reviewer Program
I am happy with the iPhone 11 phone case. The Hard Plastic Shell is of pretty good quality. I am sure my niece is going to love it when she receives it for her Xmas present as it is a unique phone case for her with photos of her family, boyfriend, and her name in a very pretty font. The printing turned out fine with very clear photos and her name.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lawana H.29 January 2022Verified Purchase
Zazzle Reviewer Program
It was very nice the pictures were placed the way i put them. the printing was fine
from zazzle.com (US)

Tags

Casemate Cases
achievementamateurdecrustifierglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementamateurdecrustifierglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 179322061383846899
Added on 12/10/14, 12:18 pm
Rating: G