Tap / click on image to see more RealViewsTM
$38.80
per roll
 

Gift Wrap - Two Kittens

Qty:

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Matte Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and five different sizes, our wrapping paper covers all your gift wrapping needs - because presentation matters as much as the gift!

  • 64lb print quality matte paper
  • Ideal for printing photos
  • Full colour edge-to-edge printing
  • Width: 74 cm
  • Length: multiple options from 1.8 m to 18.3 m
  • Each roll up to 4.6 m in length; lengths greater than 4.6 m shipped as multiple 4.6 m rolls
  • Length guide:
    • 1.8 m roll wraps 3 shirt-sized boxes
    • 4.6 m roll wraps 9 shirt-sized boxes
    • 9.1 m roll wraps 18 shirt-sized boxes
    • 13.7 m roll wraps 27 shirt-sized boxes
    • 18.3 m roll wraps 36 shirt-sized boxes
  • Designable area is 91 x 76 cm, but scaled down uniformly and printed at 88.4 x 73.7 cm
  • Please note: Designs are tiled after first 88.4 x 73.7 cm printed section

About This Design

Gift Wrap - Two Kittens

Gift Wrap - Two Kittens

This gift wrap was designed with free public domain vintage artwork.

Customer Reviews

4.7 out of 5 stars rating4.1K Total Reviews
3445 total 5-star reviews383 total 4-star reviews115 total 3-star reviews75 total 2-star reviews109 total 1-star reviews
4,127 Reviews
Reviews for similar products
5 out of 5 stars rating
By Trish C.20 November 2020Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
I needed a vintage looking paper to line some draws of some furniture I upcycled and this gingham paper fit the bill perfectly. The paper was very easy to use and it turned out beautifully. The colour and quality was excellent.
5 out of 5 stars rating
By Siobhan S.31 October 2019Verified Purchase
Wrapping Paper, Glossy Wrapping Paper
Zazzle Reviewer Program
The colours are amazing I will definitely be buying this one again. Excellent.............................................
5 out of 5 stars rating
By Trish C.20 November 2020Verified Purchase
Wrapping Paper, Glossy Wrapping Paper
Zazzle Reviewer Program
I read a recommendation for this product for decoupaging on furniture and thought I’d give it a try. It lived up to the hype and turned out beautifully. The paper was of good quality and therefore very easy to use. The colours were vibrant and looked exactly like what it was meant to.

Tags

Wrapping Paper
giftwrapgiftwrapvchdgirlkittenkittenskittycatbaby
All Products
giftwrapgiftwrapvchdgirlkittenkittenskittycatbaby

Other Info

Product ID: 256780920773533187
Added on 9/6/16, 1:30 pm
Rating: G