Tap / click on image to see more RealViewsTM
$128.30
per window cling
 

Generic Customise Fried Crispy Chicken Front

Qty:
Personalise this template
[30.0000,39.0000]
Automatic Opaque Design: White Underbase
Custom Cut

Other designs from this category

About Window Clings

Sold by

Shape: Custom Cut

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 10cm x 10cm to a max of 132cm x 183cm (or max 183cm x 132cm if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Automatic Opaque Design: White Underbase

Art is printed on a transparent sheet of plastic, but white ink is printed beneath all art, making those areas opaqaue while also making colors vivid

Adhesive: Cling art faces outwards

The adhesive side is on the front of the window cling. All text and art are printed on the front of the window cling and face away from the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the opposite side of the window where it has been applied.

About This Design

Generic Customise Fried Crispy Chicken Front

Generic Customise Fried Crispy Chicken Front

I created this Generic Customise Fried Crispy Chicken Front Window Cling for convenience, corner stores and gas stations that sell chicken to their customers. I used the Mister Earl font with a shadow to give the design some down home character. I will be adding several smaller sizes of this design to my Convenience Corner Store Banners & Signs collection. That way you don't have to play with the sizing.

Customer Reviews

3.6 out of 5 stars rating210 Total Reviews
121 total 5-star reviews12 total 4-star reviews6 total 3-star reviews12 total 2-star reviews59 total 1-star reviews
210 Reviews
Reviews for similar products
4 out of 5 stars rating
By Pirkko B.4 December 2024Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Custom Cut, Display: Back of Cling, Window Cling
Product was nice quality unfortunately I chose the wrong backing which was transparent. I could not see the decal properly .
5 out of 5 stars rating
By Joanne S.18 September 2023Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Front of Cling, Window Cling
Zazzle Reviewer Program
Wonderful Product , looks very professional. Perfect, so happy with quality
5 out of 5 stars rating
By Evgeny P.6 November 2025Verified Purchase
Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
Creator Review
Went out stylish. The cut lines are thin, and extra light definitely helps when cutting. Love the end result!
from zazzle.com (US)

Tags

Window Clings
chicken front window clinggenericcustomisefriedcrispychickensignpersonalise fried chicken sign
All Products
chicken front window clinggenericcustomisefriedcrispychickensignpersonalise fried chicken sign

Other Info

Product ID: 256160235367272287
Added on 22/6/22, 9:09 am
Rating: G