Tap / click on image to see more RealViewsTM
Sale Price $28.99.  
Original Price $34.10 per shirt
You save 15%

Future Doctor Baby Bodysuit

Qty:
Baby Jersey Bodysuit
-$4.55
White
Classic Printing: No Underbase
Vivid Printing: White Underbase
+$5.90
+$5.90
+$5.90
+$5.90

Other designs from this category

About T-Shirts

Sold by

Style: Baby Jersey Bodysuit

Not all baby bodysuits are created equal – this popular style is a must-have for your precious little bundle. The neckband is designed for easy on-and-off and a three-snap closure makes diaper changes a cinch. Personalise it with a custom image or message or dress it up with a cute pair of socks and hat or hair accessory. There's no wrong way to wear this super soft bodysuit.

Size & Fit
  • Standard fit
  • Garment is unisex sizing
  • Flatlock seams, reinforced three snap closure
  • Fits true to size
Fabric & Care
  • 127g, 100% combed ring spun cotton (Heather is 93/7) jersey
  • Double-needle ribbed binding on all openings
  • EasyTear™ label
  • White is sewn with 100% cotton thread
  • Machine washable. Washing before first use is recommended
Fully committed to providing high quality and safe products, all Zazzle baby products are Consumer Product Safety Improvement Act (CPSIA) compliant. Tracking label available in side seam.

About This Design

Future Doctor Baby Bodysuit

Future Doctor Baby Bodysuit

Future Doctor with stethoscope motif. Nice gifts!

Customer Reviews

4.6 out of 5 stars rating2.6K Total Reviews
1973 total 5-star reviews417 total 4-star reviews107 total 3-star reviews47 total 2-star reviews44 total 1-star reviews
2,588 Reviews
Reviews for similar products
5 out of 5 stars rating
By T.8 May 2016Verified Purchase
Baby Jersey Bodysuit, White, 18 to 24 Month
Zazzle Reviewer Program
Surprised my friend by sending this to her house and it arrived today. She loves it, I'm super happy! Colour was perfect, everything was exactly like the picture!
2 out of 5 stars rating
By H.10 February 2020Verified Purchase
Baby Jersey Bodysuit, White, Newborn
Zazzle Reviewer Program
Positive: It came a week after ordering it. Negative: The blue colour zazzle package got stuck in my thumbs when trying to open the package. Not so happy about it. The colours are not bright or vibrant. It kind of looks dirty. There's a bit of balck fluff on it. The colors did not turn out as expected and I am not satified with the image quality.
2 out of 5 stars rating
By S.22 February 2024Verified Purchase
Baby Jersey Bodysuit, White, Newborn
Zazzle Reviewer Program
Cute design and was delivered really quickly. Unfortunately when printed, it came out way smaller than how the preview showed. Design is too small, but looked way larger according to the preview.

Tags

T-Shirts
doctorfuture doctorphysicianmedicalchildrenkidsinfantshospitalnew babybaby shower
All Products
doctorfuture doctorphysicianmedicalchildrenkidsinfantshospitalnew babybaby shower

Other Info

Product ID: 235157508766142999
Added on 14/10/21, 4:00 pm
Rating: G