Tap / click on image to see more RealViewsTM
$15.00
$2.50 per coaster
 

First Fibonacci Plaid Square Paper Coaster

Qty:
Square
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05

Other designs from this category

About Paper Coasters

Sold by

Shape: Square

Don't be the nagging host sneakily slipping coasters under glasses. Add a personalised touch to your next party and make coasters fun with these fully customisable versions. Perfect for cocktail hours, wedding receptions and even kids' parties. Stock up today and never see a water ring again!

  • Square Dimensions: 10 cm x 10 cm (4" x 4").
  • Sold in sets of 6.
  • Available in 7 different shapes
  • Printed in full colour on one side.
  • Made with 50 pt. pulp board.
  • Sturdy, durable, absorbent and perfect for parties, weddings or branding your business.

About This Design

First Fibonacci Plaid Square Paper Coaster

First Fibonacci Plaid Square Paper Coaster

Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the colour then using the Fibonacci sequence to define the strand count.

Customer Reviews

4.7 out of 5 stars rating643 Total Reviews
531 total 5-star reviews80 total 4-star reviews16 total 3-star reviews8 total 2-star reviews8 total 1-star reviews
643 Reviews
Reviews for similar products
5 out of 5 stars rating
By Rachel S.1 April 2022Verified Purchase
Round Coasters
Zazzle Reviewer Program
My parents really loved these. Am really happy with how they turned out and that they're purchased individually, so you can order however many you want. Bought these at the same time as another gift but this item didn't turn up. Contacted Zazzle about this and they were on it straight away and immediately re-ordered more. Ended up with 2 sets as the 1st set turned up days before the 2nd set. Customer service was excellent. Printing turned out great, nice and clear.
5 out of 5 stars rating
By Jennefer M.28 September 2025Verified Purchase
Round Coasters
This is the second order of these coasters - I love the quality and that I can design them myself to fit my decor and when they are getting old and stained I can recycle them and order more! .
1 out of 5 stars rating
By Anonymous21 July 2025Verified Purchase
Square Coasters
I ordered 70 coasters all together. Only 27 came out ok. The print is very low quality and even the cut of the square is very rough. Very disappointing considering I spent nearly $200.

Tags

Paper Coasters
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright
All Products
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright

Other Info

Product ID: 256165514977023455
Added on 1/3/16, 10:14 am
Rating: G