Tap / click on image to see more RealViewsTM
$63.85
per tie
 

First Fibonacci Plaid Nerdy Math Tartan Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm
    • Width: 10.1 cm (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

First Fibonacci Plaid Nerdy Math Tartan Tie

First Fibonacci Plaid Nerdy Math Tartan Tie

Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the colour then using the Fibonacci sequence to define the strand count.

Customer Reviews

4.5 out of 5 stars rating2.5K Total Reviews
1841 total 5-star reviews330 total 4-star reviews138 total 3-star reviews71 total 2-star reviews117 total 1-star reviews
2,497 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Amy C.17 May 2022Verified Purchase
Tie
Zazzle Reviewer Program
It's absolutely perfect!! Turned out much better then I expected ❤️ It is a little expensive but very worth it. Printing is perfect can read it very well
4.0 out of 5 stars rating
4 out of 5 stars rating
By Anonymous14 September 2025Verified Purchase
Tie
I originally ordered 1 tie to test and ensure I liked it with the suits we had ordered! The tie came and it was perfect! We loved it! The colours were bright and the tie was beautifully made. I then ordered the 6 additional ties and the colours are slightly different. The 6 ties were a little less vibrant and the white background was slightly different! .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous6 April 2025Verified Purchase
Tie
Lovely. My English class was impressed!

Tags

Ties
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright
All Products
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright

Other Info

Product ID: 151220032616911856
Added on 20/2/16, 12:52 pm
Rating: G