Tap / click on image to see more RealViewsTM
Sale Price $42.16.  
Original Price $52.70 per tie
You save 20% ends today

First Fibonacci Plaid Nerdy Math Tartan Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm
    • Width: 10.1 cm (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

First Fibonacci Plaid Nerdy Math Tartan Tie

First Fibonacci Plaid Nerdy Math Tartan Tie

Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the colour then using the Fibonacci sequence to define the strand count.

Customer Reviews

4.5 out of 5 stars rating2.4K Total Reviews
1798 total 5-star reviews327 total 4-star reviews128 total 3-star reviews64 total 2-star reviews97 total 1-star reviews
2,414 Reviews
Reviews for similar products
4 out of 5 stars rating
By Anonymous14 September 2025Verified Purchase
Tie
I originally ordered 1 tie to test and ensure I liked it with the suits we had ordered! The tie came and it was perfect! We loved it! The colours were bright and the tie was beautifully made. I then ordered the 6 additional ties and the colours are slightly different. The 6 ties were a little less vibrant and the white background was slightly different! .
5 out of 5 stars rating
By Amy C.17 May 2022Verified Purchase
Tie
Zazzle Reviewer Program
It's absolutely perfect!! Turned out much better then I expected ❤️ It is a little expensive but very worth it. Printing is perfect can read it very well
5 out of 5 stars rating
By jon n.28 January 2023Verified Purchase
Tie
Zazzle Reviewer Program
This is an awesome German Flag tie ! The quality and the printing of this tie is perfect and is equal to what you see on the screen. I selected this tie because not only does it look 'rock'n'roll' the 'faded grungy' look goes perfect with my 'metal rockstar' look. The printing on the tie is perfect. 10 out of 10.

Tags

Ties
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright
All Products
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright

Other Info

Product ID: 151220032616911856
Added on 20/2/16, 12:52 pm
Rating: G