Tap / click on image to see more RealViewsTM
$43.90
per pack of 100
 

Farmers Market Organic Fresh Eggs Chicken Business Card

Collection
Qty:
Squared
+$11.05
Signature Matte

17.5 pt thickness / 324 GSM weight
Light eggshell white, uncoated matte finish

+$10.50
+$10.50
+$10.50
+$20.95
+$20.95

Other designs from this category

Shop this collection

Dhouha Zarria
Fresh Eggs Collection Designed by Dhouha Zarria
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Business Cards

Sold by

Size: American, 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm x 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature Matte

A classic, all around paper with a natural feel and an uncoated matte finish; our Standard Matte stands the test of time. Elegant and understated, colours print softer and more subtle.

  • 17.5 pt thickness / 324 GSM weight
  • Light white, uncoated matte finish with an eggshell texture
  • Paper is easy to write on and won't smudge

About This Design

Farmers Market Organic Fresh Eggs Chicken  Business Card

Farmers Market Organic Fresh Eggs Chicken Business Card

Make a lasting impression with this clean and professional business card. Perfect for your farmers market stall, it highlights the quality and freshness of your organic eggs. Featuring a sleek design with a charming chicken motif, it’s an excellent way to promote your farm business and connect with customers.

Customer Reviews

4.7 out of 5 stars rating39.4K Total Reviews
32882 total 5-star reviews3864 total 4-star reviews1009 total 3-star reviews629 total 2-star reviews983 total 1-star reviews
39,367 Reviews
Reviews for similar products
4 out of 5 stars rating
By Elizabeth S.6 May 2024Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle provides a way to modify the card designs & that is very useful. My order arrived 2 weeks from tthe order date. The card looks great. I would have liked some more design options such as stock images, such as some wedding rings, which I would have liked to include on my business card. Packaging - one suggestion for improvement - post in a sturdy postal box. Mine were in a small box, inside a flat postal bag. During postage the box had been squashed & all my 100 cards were loose inside the postal bsg. Fortunately none were damaged. Looks great. Option to have raised letters would be a welcome additionsl option.
5 out of 5 stars rating
By Shauna Y.1 November 2021Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle Reviewer Program
This product was just what I was hoping for. It arrived faster than I expected and exceeded my expectations. The design turned out perfect and I was blown away with the quality and detail of the product. I have since bought 300 more.
5 out of 5 stars rating
By Ronnie A.5 January 2020Verified Purchase
Business Card, Size: Square, 64 mm x 64 mm,Paper: Signature UV Matte, Corners: Squared
Zazzle Reviewer Program
I ordered these cards as my business cards and I could not be happier. Beautiful quality card, clear writing and vibrant colours. I love the square size, they stand out as being different. They arrived a lot sooner than expected as well which was a pleasant surprise. Gorgeous vibrant colours, clear printing, I couldn't have asked for more.

Tags

Business Cards
farmers marketrusticcountryfarmhousechickenfarmvintagechickensfamily farmegg business cards
All Products
farmers marketrusticcountryfarmhousechickenfarmvintagechickensfamily farmegg business cards

Other Info

Product ID: 256877951835633484
Added on 21/6/24, 1:10 pm
Rating: G