Sell on Zazzle
Tap / click on image to see more RealViewsTM
$31.20
per keychain
 

Family Time , Family Adventure Key Ring

4.8 out of 5 stars rating
992 Total Reviews |
by
Qty:
Shape
Circle (single-sided)

Other designs from this category

About Key Chains

Sold by
Acrylic Keychain
Create your own from scratch

Shape: Circle (single-sided)

Never leave home without your favourite photo, design, or inspirational message attached to your keys with this custom circle key ring. Designed to withstand daily wear and tear, this key ring displays designs, text, and photos in vibrant clarity and brilliant colours.

  • Dimensionen: 5 cm diameter (2")
  • Made of ultra-durable acrylic
  • UV resistant and waterproof
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 5 cm x 5 cm (2" x 2"). For best results please add 0.15 cm (.12") bleed..

About This Design

Family Time , Family Adventure Key Ring

Family Time , Family Adventure Key Ring

Keep your keys organised and add a touch of wanderlust to your everyday life with the "Family Time Travel" Key Chain. Designed with a beautiful and inspiring motif, this key chain celebrates the spirit of family and vacation travelling. Whether you're unlocking the door to your home or embarking on a new adventure, this key chain will serve as a constant reminder of the joy of exploring new destinations with your loved ones. Carry your keys with style and let your wanderlust shine wherever you go.
Ashaar Studio
Pro
Artwork designed by
Faisalabad, Punjab, Pakistan
View their Store

Customer Reviews

4.8 out of 5 stars rating992 Total Reviews
878 total 5-star reviews81 total 4-star reviews14 total 3-star reviews7 total 2-star reviews12 total 1-star reviews
992 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jen B.21 February 2022 • Verified Purchase
Acrylic Keychain, Circle (single-sided)
Zazzle Reviewer Program
I was happy with the keychain. The design is so pretty and my daughter loved it. Well made. Just as pictured. Thank you.
5 out of 5 stars rating
By Valentina P.27 September 2022 • Verified Purchase
Acrylic Keychain, Circle (single-sided)
Zazzle Reviewer Program
I searched a lot for the best personalised soccer keyings and I found them!! Such great quality and professionally done! Love them And cannot wait to give them out as gifts to our little soccer team Thank you. Personalised names are fantastic quality
5 out of 5 stars rating
By Nicole S.8 August 2024 • Verified Purchase
Acrylic Keychain, Square (single-sided)
Even better than I imagined. High quality and bigger than I expected. Exactly as ordered and easy to read - very happy.

Tags

Key Chains
familyvacationtravelkeychainadventureawaitswanderlustexploretogethertravelwithfamilyvacationmodekeychainfamilytimetravelaccessories
All Products
familyvacationtravelkeychainadventureawaitswanderlustexploretogethertravelwithfamilyvacationmodekeychainfamilytimetravelaccessories

Other Info

Product ID: 256666771340271513
Added on 10/6/23, 5:00 am
Rating: G