Tap / click on image to see more RealViewsTM
$31.20
per keychain
 

Family Time , Family Adventure Key Ring

Qty:
Circle (single-sided)

Other designs from this category

About Key Chains

Sold by

Shape: Circle (single-sided)

Never leave home without your favourite photo, design, or inspirational message attached to your keys with this custom circle key ring. Designed to withstand daily wear and tear, this key ring displays designs, text, and photos in vibrant clarity and brilliant colours.

  • Dimensionen: 5 cm diameter (2")
  • Made of ultra-durable acrylic
  • UV resistant and waterproof
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 5 cm x 5 cm (2" x 2"). For best results please add 0.15 cm (.12") bleed..

About This Design

Family Time , Family Adventure  Key Ring

Family Time , Family Adventure Key Ring

Keep your keys organised and add a touch of wanderlust to your everyday life with the "Family Time Travel" Key Chain. Designed with a beautiful and inspiring motif, this key chain celebrates the spirit of family and vacation travelling. Whether you're unlocking the door to your home or embarking on a new adventure, this key chain will serve as a constant reminder of the joy of exploring new destinations with your loved ones. Carry your keys with style and let your wanderlust shine wherever you go.

Customer Reviews

4.8 out of 5 stars rating1K Total Reviews
886 total 5-star reviews81 total 4-star reviews15 total 3-star reviews7 total 2-star reviews13 total 1-star reviews
1,002 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jen B.21 February 2022Verified Purchase
Acrylic Keychain, Circle (single-sided)
Zazzle Reviewer Program
I was happy with the keychain. The design is so pretty and my daughter loved it. Well made. Just as pictured. Thank you.
5 out of 5 stars rating
By Anonymous26 December 2025Verified Purchase
Acrylic Keychain, Circle (single-sided)
Perfect. Received looking exactly as it was meant to. Love it. .
5 out of 5 stars rating
By Valentina P.27 September 2022Verified Purchase
Acrylic Keychain, Circle (single-sided)
Zazzle Reviewer Program
I searched a lot for the best personalised soccer keyings and I found them!! Such great quality and professionally done! Love them And cannot wait to give them out as gifts to our little soccer team Thank you. Personalised names are fantastic quality

Tags

Key Chains
familyvacationtravelkeychainadventureawaitswanderlustexploretogethertravelwithfamilyvacationmodekeychainfamilytimetravelaccessories
All Products
familyvacationtravelkeychainadventureawaitswanderlustexploretogethertravelwithfamilyvacationmodekeychainfamilytimetravelaccessories

Other Info

Product ID: 256666771340271513
Added on 10/6/23, 5:00 am
Rating: G