Tap / click on image to see more RealViewsTM
$70.30
per round throw cushion
 

Fairytale Royal Carriage Glass Slipper Pumpkin Round Cushion

Qty:

About Round Cushions

Sold by

Size: Round Throw Cushion 41 x 41 cm

Zazzle cushions now come in even more sizes and shapes! Make a statement without having to say a word when you accent your home with fully customisable cushions from Zazzle. Made from high-quality fabric, these soft cushions look great with your personalised designs, quotes monograms, and photos. The perfect complement to your living room, bedroom, and more!

  • Dimensions: 40.6 cm diameter (flat), 35.5 cm (stuffed)
  • Hidden zipper enclosure; synthetic-filled insert included
  • Made in the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 40.6 cm (16" x 16"). For best results please add 1.9 cm (3/4") bleed..

Fabric: Brushed Polyester

  • 100% brushed polyester is wrinkle free
  • Vibrant colours help designs really pop
  • Heavy cotton-blend-type texture makes fabric soft to the touch
  • High tensile strength fabric make for long lasting quality
  • Inserts are hypoallergenic and filled with a faux down polyester fiber
  • Machine washable, able to retain color and resist shrinkage

About This Design

Fairytale Royal Carriage Glass Slipper Pumpkin Round Cushion

Fairytale Royal Carriage Glass Slipper Pumpkin Round Cushion

Fairytale Princess theme feather topped carriage, slipper on a pillow & pumpkin motif in colours of ivory, blush pink and aqua blue.

Customer Reviews

4.6 out of 5 stars rating318 Total Reviews
247 total 5-star reviews41 total 4-star reviews16 total 3-star reviews4 total 2-star reviews10 total 1-star reviews
318 Reviews
Reviews for similar products
5 out of 5 stars rating
By Linda M.27 July 2020Verified Purchase
Brushed Polyester Round Throw Cushion 41 x 41 cm
Zazzle Reviewer Program
This cushion is AMAZING the quality is the upmost and I would highly recommend to others. It exceeded my expectations and I would use your services again. You can see the care and attention of detail that has been put into making and designing the cushion. The cushion turned out exactly how it was shown and the fabric is excellent quality. The colours are bright and AMAZING too.
5 out of 5 stars rating
By R.29 October 2017Verified Purchase
Brushed Polyester Round Throw Cushion 41 x 41 cm
Zazzle Reviewer Program
Good size, good colour, good feel. Excellent, colours perfect
5 out of 5 stars rating
By Liz K.24 November 2017Verified Purchase
Brushed Polyester Round Throw Cushion 41 x 41 cm
Zazzle Reviewer Program
I am really happy with the way my cushion looks. I have different photos on each side, and they both turned out well. They are clear and quite bright, just the way I sent them. I like the cushion having a zip off cover for washing. I received the product in Australia, well packaged, promptly. Fabulous and well assembled.

Tags

Round Cushions
fairytalecarriagecoachpumpkinglass slipperfeminineelegantpastelgirlypink
All Products
fairytalecarriagecoachpumpkinglass slipperfeminineelegantpastelgirlypink

Other Info

Product ID: 256120776374444500
Added on 23/8/20, 10:07 am
Rating: G