Tap / click on image to see more RealViewsTM
$5.59
per card
 

Fairy Circle by Arthur Rackham Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.25

Other designs from this category

About Folded Greeting Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Thank you, hello, or I love you, custom greeting cards are thoughtful gifts that are always the perfect way to express yourself.

  • Dimensions: 12.7 cm x 17.78 cm (portrait); 17.78 cm x 12.7 cm (landscape)
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Fairy Circle by Arthur Rackham Card

Fairy Circle by Arthur Rackham Card

The fairies are celebrating. It is for A Midsummer Night's Dream. The colours are great. It is public domain.

Customer Reviews

4.9 out of 5 stars rating17.7K Total Reviews
16623 total 5-star reviews729 total 4-star reviews124 total 3-star reviews60 total 2-star reviews128 total 1-star reviews
17,664 Reviews
Reviews for similar products
5 out of 5 stars rating
By Cat S.21 November 2024Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Beautiful card and good quality.
5 out of 5 stars rating
By DARREN W.6 June 2022Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
The ude of a completely personal and very up-to-date concept using the Avatar this card will be the perfect way for me to send my love you & miss you greetings whilst I am away. Perfect print and very clear
5 out of 5 stars rating
By Lisa U.21 November 2021Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
A beautiful card. Highest quality materials and print. Misunderstood the explanation of the gold accent. I took it as the design would be metallic in its appearance. Still a lovely card and I am extremely happy with it overall. Perfect, only that I expected the gold to be metallic.

Tags

Folded Greeting Cards
fairiesfairyartarthurrackhamshakespearetreeplaywhite
All Products
fairiesfairyartarthurrackhamshakespearetreeplaywhite

Other Info

Product ID: 256603442933343167
Added on 19/3/19, 9:05 pm
Rating: G