Tap / click on image to see more RealViewsTM
$5.59
per card
 

Fairy Circle by Arthur Rackham Card

Qty:
Choose Your Format
  1. Size

  2. Envelopes

  3. Paper Type

  4. Orientation

  5. Attribution

Other designs from this category

About Folded Greeting Cards

Sold by

Size: 12,7 × 17,8 cm

Thank you, hello, or I love you, custom greeting cards are thoughtful gifts that are always the perfect way to express yourself.

  • Dimensions: 12.7 cm x 17.78 cm (portrait); 17.78 cm x 12.7 cm (landscape)
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Fairy Circle by Arthur Rackham Card

Fairy Circle by Arthur Rackham Card

The fairies are celebrating. It is for A Midsummer Night's Dream. The colours are great. It is public domain.

Customer Reviews

4.9 out of 5 stars rating18.6K Total Reviews
17444 total 5-star reviews762 total 4-star reviews145 total 3-star reviews76 total 2-star reviews194 total 1-star reviews
18,621 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Margaret G.22 July 2024Verified Purchase
Folded Greeting Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte, Envelopes: White
This little card was so nice. I luve across the other side if the world from my grandchildren and it's always lovely to be able to send them a nice card for their birthdays. The picture on the front wS so sharp and true to the original.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Cat S.21 November 2024Verified Purchase
Folded Greeting Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte, Envelopes: White
Beautiful card and good quality.
5.0 out of 5 stars rating
5 out of 5 stars rating
By DARREN W.6 June 2022Verified Purchase
Folded Greeting Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
The ude of a completely personal and very up-to-date concept using the Avatar this card will be the perfect way for me to send my love you & miss you greetings whilst I am away. Perfect print and very clear

Tags

Folded Greeting Cards
fairiesfairyartarthurrackhamshakespearetreeplaywhite
All Products
fairiesfairyartarthurrackhamshakespearetreeplaywhite

Other Info

Product ID: 256603442933343167
Added on 19/3/19, 9:05 pm
Rating: G