Tap / click on image to see more RealViewsTM
$5.59
per card
 

Fairy Circle by Arthur Rackham Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.25

Other designs from this category

About Folded Greeting Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Thank you, hello, or I love you, custom greeting cards are thoughtful gifts that are always the perfect way to express yourself.

  • Dimensions: 12.7 cm x 17.78 cm (portrait); 17.78 cm x 12.7 cm (landscape)
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Fairy Circle by Arthur Rackham Card

Fairy Circle by Arthur Rackham Card

The fairies are celebrating. It is for A Midsummer Night's Dream. The colours are great. It is public domain.

Customer Reviews

4.9 out of 5 stars rating18K Total Reviews
16891 total 5-star reviews741 total 4-star reviews130 total 3-star reviews64 total 2-star reviews145 total 1-star reviews
17,971 Reviews
Reviews for similar products
5 out of 5 stars rating
By Cat S.21 November 2024Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Beautiful card and good quality.
5 out of 5 stars rating
By DARREN W.6 June 2022Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
The ude of a completely personal and very up-to-date concept using the Avatar this card will be the perfect way for me to send my love you & miss you greetings whilst I am away. Perfect print and very clear
5 out of 5 stars rating
By Lisa U.21 November 2021Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
A beautiful card. Highest quality materials and print. Misunderstood the explanation of the gold accent. I took it as the design would be metallic in its appearance. Still a lovely card and I am extremely happy with it overall. Perfect, only that I expected the gold to be metallic.

Tags

Folded Greeting Cards
fairiesfairyartarthurrackhamshakespearetreeplaywhite
All Products
fairiesfairyartarthurrackhamshakespearetreeplaywhite

Other Info

Product ID: 256603442933343167
Added on 19/3/19, 9:05 pm
Rating: G