Tap / click on image to see more RealViewsTM
$17.80
per sheet of 20
 

Elf with White Cat Riding on a Leaf Stickers 2

Qty:
Square Stickers
+$0.65
+$0.65
+$0.65

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Elf with White Cat Riding on a Leaf Stickers 2

Elf with White Cat Riding on a Leaf Stickers 2

these are lovely for your scrapbooking projects - to label items - or just envelope seals... © 2004-2015 MarloDee Designs (www.marlodeedesigns.com) : All rights reserved. Images on this site are not public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing.

Customer Reviews

4.8 out of 5 stars rating27.4K Total Reviews
23732 total 5-star reviews2248 total 4-star reviews560 total 3-star reviews342 total 2-star reviews528 total 1-star reviews
27,410 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tracey B.4 January 2022Verified Purchase
Zazzle Reviewer Program
I love the stickers,to get something so personal is awsome. The quality was fantastic.
5 out of 5 stars rating
By S.10 November 2020Verified Purchase
Zazzle Reviewer Program
The stickers are great quality and so pretty their suit their purpose to a T. I'm in love with them postage was a tad slow but I didn't pay for express so probably my own fault. Absolutely stunning
5 out of 5 stars rating
By Hannah D.19 March 2022Verified Purchase
Zazzle Reviewer Program
I use this design often for candles I make for family + friends. The design is beautiful, easy to edit + always looks great! Printing is always spot on for the small labels I use

Tags

All Products
fantasyfaefairyelfelveselvishmagicspellmother naturebeautiful

Other Info

Product ID: 217199683751234378
Added on 11/10/11, 1:03 pm
Rating: G