Tap / click on image to see more RealViewsTM
$17.80
per sheet of 20
 

Elf Designs :: Magical by MarloDee Designs Square Sticker

Qty:
  1. Shape

  2. Format

  3. Size

  4. Paper Type

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Elf Designs :: Magical by MarloDee Designs Square Sticker

Elf Designs :: Magical by MarloDee Designs Square Sticker

A lovely elf and a hummingbird together is Magical....( © 2004-2015 MarloDee Designs (www.marlodeedesigns.com) : All rights reserved. Images on this site are not public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing.

Customer Reviews

4.8 out of 5 stars rating27.8K Total Reviews
23994 total 5-star reviews2272 total 4-star reviews593 total 3-star reviews374 total 2-star reviews583 total 1-star reviews
27,816 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Belinda T.4 January 2022Verified Purchase
Zazzle Reviewer Program
I love the stickers,to get something so personal is awsome. The quality was fantastic.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Dale R.4 August 2026Verified Purchase
Fast delivery very helpful .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Hannah D.19 March 2022Verified Purchase
Zazzle Reviewer Program
I use this design often for candles I make for family + friends. The design is beautiful, easy to edit + always looks great! Printing is always spot on for the small labels I use

Tags

All Products
elffairyfaemagicmagikmagikalwitchhummingbirdfantasyspell

Other Info

Product ID: 217259878938441739
Added on 11/10/11, 1:05 pm
Rating: G