Tap / click on image to see more RealViewsTM
$35.10
per towel
 

Elegant Thanksgiving Pear Wreath Illustration Tea Towel

Qty:

Other designs from this category

About Kitchen Towels

Sold by

Style: Tea Towel 40.6 cm x 61 cm

Brighten up any kitchen with a set of new kitchen towels! Made of durable poly-blend, these towels are great for drying and will look vibrant with your text, monogram or artwork. Designed for a lifetime of use, these machine washable kitchen towels look great and clean up well, too!

  • Dimensions: 40.6 cm x 60.9 cm
  • Durable woven polyester / polyamide blend microfibre; 80% Polyester / 20% Polyamide
  • Machine washable
  • Made and shipped from the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 60.9 cm (16" x 24"). For best results please add 1.8 cm (5/7") bleed..

About This Design

Elegant Thanksgiving Pear Wreath Illustration Tea Towel

Elegant Thanksgiving Pear Wreath Illustration Tea Towel

Modern Thanksgiving Wreath Fall Motif Towel

Customer Reviews

4.7 out of 5 stars rating1.2K Total Reviews
1040 total 5-star reviews127 total 4-star reviews37 total 3-star reviews13 total 2-star reviews19 total 1-star reviews
1,236 Reviews
Reviews for similar products
4 out of 5 stars rating
By Sharon C.21 February 2024Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Feedback from those I gave them to was very positive, and they mentioned the material as being good. Happy with the print
5 out of 5 stars rating
By Anonymous26 December 2025Verified Purchase
Kitchen Towel
Great product, fast service, very happy, highly recommend!
5 out of 5 stars rating
By Julie b.7 June 2025Verified Purchase
Kitchen Towel
The recipient loved it great gift idea.

Tags

Kitchen Towels
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 197652513096200298
Added on 1/11/20, 7:18 am
Rating: G