Tap / click on image to see more RealViewsTM
$92.85
per set of 50 napkins
 

Elegant Thanksgiving Pear Wreath Illustration Napkin

Qty:
White

Other designs from this category

About Paper Napkins

Sold by

Style: Standard Cocktail

A good celebration is as much about the presentation as it is about food. Serve up the party with custom personalised paper napkins that look good tucked in the collar or draped over your lap.

  • Dimensions: 12 cm l x 12 w cm (folded), 3 ply
  • Printed in full colour on your choice of white or ecru coloured napkins
  • Coined or standard napkin styles available
  • Sold in quantities of 50
  • Buy in bulk and save!
  • This product is food contact safe
Tip: When ordering napkins, the general rule is 3 napkins per guest.

About This Design

Elegant Thanksgiving Pear Wreath Illustration Napkin

Elegant Thanksgiving Pear Wreath Illustration Napkin

Modern Thanksgiving Wreath Fall Motif Elements for Thanksgiving Gifts

Customer Reviews

4.6 out of 5 stars rating109 Total Reviews
88 total 5-star reviews10 total 4-star reviews4 total 3-star reviews2 total 2-star reviews5 total 1-star reviews
109 Reviews
Reviews for similar products
5 out of 5 stars rating
By Shelley T.6 November 2022Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
I bought these for friends who have a little black labrador identical to the one pictured. They absolutely loved them and are going to frame one. I LOVE Zazzle and recommend it to all my friends. The little pup is perfect
5 out of 5 stars rating
By Jeffrey C.5 November 2019Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
This cheeky quokka napkin made the best of part conversation pieces. It seemed a shame to wipe one's face on it. Layer-upon-layer of meaning was slowly revealed in the quokka's expression and enigmatic body language as the cocktails started taking effect. The product arrived in a handy box so that dust did not gather on the napkins beforehand. This was an excellent, good-resolution representation of a quokka. The image was large and the animal nicely centered. The paper quality was also of an acceptable softness.
5 out of 5 stars rating
By Norma H.22 August 2020Verified Purchase
Paper Napkins, Standard Luncheon
Zazzle Reviewer Program
I love this design, so much that I am building a Christmas Party with "Silent Night, Holy Night" theme. I have been building a supply of items featuring this design. The colours and printing are brilliant and will decorate my table for fine dinning with these napkins.

Tags

Paper Napkins
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 256037812667762383
Added on 1/11/20, 6:06 am
Rating: G