Tap / click on image to see more RealViewsTM
$40.10
per keychain
 

Elegant Thanksgiving Pear Wreath Illustration Key Ring

Qty:
Personalise this template
Square (single-sided)

Other designs from this category

About Key Chains

Sold by

Shape: Square (single-sided)

Never leave home without your favourite photo, design, or inspirational message attached to your keys with this custom circle key ring. Designed to withstand daily wear and tear, this key ring displays designs, text, and photos in vibrant clarity and brilliant colours.

  • Dimensions: 4.7 cm x 4.7 cm (1.875" x 1.875")
  • Made of ultra-durable acrylic
  • UV resistant and waterproof
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 4.7 cm x 4.7 cm (1.875" x 1.875"). For best results please add 0.15 cm (.12") bleed..

About This Design

Elegant Thanksgiving Pear Wreath Illustration Key Ring

Elegant Thanksgiving Pear Wreath Illustration Key Ring

Modern Thanksgiving Wreath Fall Motif Elements for Thanksgiving Gifts

Customer Reviews

4.8 out of 5 stars rating992 Total Reviews
878 total 5-star reviews81 total 4-star reviews14 total 3-star reviews7 total 2-star reviews12 total 1-star reviews
992 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ann P.26 August 2019Verified Purchase
Acrylic Keychain, Square (single-sided)
Zazzle Reviewer Program
Maybe you could prompt customers that they can write on the back also. Very satisfied Thankyou
5 out of 5 stars rating
By Deborah R.8 January 2018Verified Purchase
Acrylic Keychain, Square (single-sided)
Zazzle Reviewer Program
Beautiful key ring exactly what I wanted. Beautifully done , that is all I’ll say
5 out of 5 stars rating
By Jessica V.10 December 2019Verified Purchase
Acrylic Keychain, Square (double-sided)
Zazzle Reviewer Program
Great quality and good value. Perfect printing. Looks exactly like a photo in high res

Tags

Key Chains
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 256155350948813937
Added on 1/11/20, 6:35 am
Rating: G