Tap / click on image to see more RealViewsTM
$27.55
per mouse pad
 

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Pad

Qty:
Personalise this template

Other designs from this category

About Mousepads

Sold by

Style: Mouse Pad

Create a great accessory for the only mouse you want scurrying around with a custom mouse pad for your home or office! Decorate it with your favourite image or choose from thousands of designs that look great and protect your mouse from scratches and debris. You can also design fun mouse pads to hand out to new employees or to use as marketing materials!

  • Dimensions: 23.49 cm l x 19.68 cm w
  • High quality, full-colour printing
  • Durable and dust and stain resistant cloth cover
  • Non-slip rubber backing
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 23.49 cm x 19.68 cm

About This Design

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Pad

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Pad

Chic vintage look with a customisable background colour. Original leave pattern motif by Village Design.

Customer Reviews

4.8 out of 5 stars rating4.7K Total Reviews
4226 total 5-star reviews386 total 4-star reviews73 total 3-star reviews27 total 2-star reviews27 total 1-star reviews
4,739 Reviews
Reviews for similar products
5 out of 5 stars rating
By R.20 December 2021Verified Purchase
Mousepad
Zazzle Reviewer Program
Item was well packed and arrived quickly. The item was of great quality, beautiful colours and well made.
5 out of 5 stars rating
By Marie M.28 January 2022Verified Purchase
Mousepad
Zazzle Reviewer Program
First time ordering with Zazzle so did not know what to expect but it was delivered promptly and has a lovely feel. Wanted a new mouse mat & only ones available were $2 cheap & nasty. Use it with the Peacock Eyes at the top and it looks and feel great. Very happy with printing colours excellent.
4 out of 5 stars rating
By F.16 June 2020Verified Purchase
Mousepad
Zazzle Reviewer Program
The experience buying from Zazzle was great -- the custom made product arrived much faster than I expected (I am in Australia) and they kept me updated with progress emails. The product itself is good quality and I like the simplistic elegant design. The only criticism I have is that it's not really accurately represented by the picture provided. I thought that the mousepad would be a non-porous or laminate surface and as such the gold writing would actually shine against the soft pink. However the design is printed on a thick fabric surface, so the gold colour is just the shade of gold but doesn't stand out from the pink background. (See picture) FYI the soft pink is stronger in real life than in my personal picture. Good quality printing, slightly different look to what I expected. It also smells quite strong on arrival but it's only been a day so this may fade. FYI the soft pink is stronger in real life than in my personal picture.

Tags

Mousepads
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant
All Products
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant

Other Info

Product ID: 144388314163988114
Added on 29/10/12, 2:02 pm
Rating: G