Tap / click on image to see more RealViewsTM
The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
$82.80
per clock
 

Elegant Blush Pink & Silver Glitter Drip Square Wall Clock

Qty:
27.3 cm Square Acrylic
-$9.55
-$18.80
-$18.80
-$18.80

Other designs from this category

About Wall Clocks

Sold by

Style: 27.3 cm Square Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • Size: 27.3 cm L x 27.3 cm H
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use
California Residents: Prop 65 Disclaimer
WarningWARNING: This product can expose you to chemicals including lead, which is known to the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

About This Design

The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Elegant Blush Pink & Silver Glitter Drip  Square Wall Clock

Elegant Blush Pink & Silver Glitter Drip Square Wall Clock

Add a touch of luxury to your space with this elegant Pink Luxe Drip wall clock, featuring shimmering silver and blush pink glitter drips in a circular-shaped motif. Perfect for glam rooms, modern bedrooms, or feminine office décor, this chic timepiece is as functional as it is fabulous. A stunning gift for housewarmings, birthdays, or anyone who loves a little sparkle!

Customer Reviews

4.7 out of 5 stars rating3.6K Total Reviews
2968 total 5-star reviews395 total 4-star reviews81 total 3-star reviews42 total 2-star reviews66 total 1-star reviews
3,552 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous28 November 2022Verified Purchase
Wall Clock, 27.3 cm Square Acrylic
Zazzle Reviewer Program
These days, shopping on line can be a little daunting at times, not seeing or trying the product off the shelf in a store, never knowing for sure what to expect (I've been very disappointed a few times let me tell you) Our custom clock arrived today (Melbourne, Australia) - First thing that impressed straight away was the packaging, solid and well designed. Then when we unwrapped, well, absolutely thrilled to say the least. Extremely high quality product, well exceeding our brightest hopes. Will we shop again ? No hesitation - Can we recommend ? 100% :). The product we received was actually better than the photo on screen. Rich deep colors and clean crisp edges with a highly polished clock face. Loving it.
5 out of 5 stars rating
By Hala A.6 October 2021Verified Purchase
Wall Clock, 27.3 cm Square Acrylic
Zazzle Reviewer Program
Good quatity and will last for long. Very good priniting
5 out of 5 stars rating
By Robert P.8 November 2023Verified Purchase
Wall Clock, 27.3 cm Square Acrylic
Zazzle Reviewer Program
This is a great design.Colours are terrific.My second clock from ZAZZLE and I must say it is just another great choice. The colours and picture are wonderful.

Tags

Wall Clocks
sparkleglittermodernglamelegantgirlysilverpink
All Products
sparkleglittermodernglamelegantgirlysilverpink

Other Info

Product ID: 256577969356106432
Added on 4/9/25, 12:24 pm
Rating: G