Sell on Zazzle
Tap / click on image to see more RealViewsTM
$11.65
per sticker
 

Discover Hidden Wonders - Vintage Magnifying Glass

4.9 out of 5 stars rating
37 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Medium 15.24 cm x15.24 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 15.24 cm L x 16.51 cm H
  • Design Area: 15.24 cm L x 15.24 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Discover Hidden Wonders - Vintage Magnifying Glass

Discover Hidden Wonders - Vintage Magnifying Glass

Unearth the magic of nostalgia with our Vintage Magnifying Glass Sticker! Dive into the enchanting world of discovery and wonder as you explore the intricacies of this cool vintage illustration. This sticker isn't just an accessory; it's a gateway to a world filled with art, history, and the joy of exploration. Whether you're a lover of art, history, or simply appreciate the beauty of intricate design, this sticker brings a touch of aesthetic elegance to your life. Feel the excitement of a new adventure every time you gaze upon this meticulously crafted piece. Printed on-demand exclusively for you, this sticker embodies the essence of your passions - art, history, and the desire to connect with the beauty of the past. Peel it, stick it, and let it transport you to a place where curiosity knows no bounds. Embrace the spirit of discovery and turn any surface into a canvas of imagination. Get your Vintage Magnifying Glass Sticker today, and let the journey begin. It's not just a sticker; it's a feeling waiting to be discovered.
Brand New Retro Art
Pro
Artwork designed by
Sremski Karlovci, Vojvodina, Serbia
View their Store

Customer Reviews

4.9 out of 5 stars rating37 Total Reviews
35 total 5-star reviews2 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
37 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tania K.8 November 2020 • Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Ordered online, item was produce and shipped and received in great time. I was worried about ordering something from overseas. Don't need to worry with Zazzle. I would use them again. Exactly what I wanted. Love it
5 out of 5 stars rating
By Debra S.10 July 2024 • Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
A+ Love these stickers! All my friends know if this sticker is on something it belongs to me. They are great quality. They don’t peel and are water resistant. I give them away as gifts and they are grilled to receive. Printing is first class! Colors are beautiful and don’t fade or peel. The design is nice on the eyes and decorate all kinds of things.
from zazzle.com (US)
5 out of 5 stars rating
By GINA A.27 July 2020 • Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The sticker paper is sturdy, the colors are vibrant, and the adhesive is strong. Sticker is exactly what I wanted. Perfect for me to express both sides of my personality, cute and creepy, every day. Very satisfied with my purchase! The image is clear and cleans. The colors are vibrant.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
magnifying glasscoolvintageillustrationretrographicmagnifyingmagnifynewspapermagnifier
All Products
magnifying glasscoolvintageillustrationretrographicmagnifyingmagnifynewspapermagnifier

Other Info

Product ID: 256837628795514461
Added on 18/3/23, 9:44 am
Rating: G