Tap / click on image to see more RealViewsTM
The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
$20.30
per notebook
 

Daisy Chain - Notebook (Bright Pink)

Qty:

    Other designs from this category

    About Notebooks

    Sold by

    Style: 16.51 cm x 22.22 cm Classic Notebook

    Organise your day with a custom notebook! Made with your images and text on the front cover, this notebook is a great way to show off your personal style and keep track of all important notes and appointments all at once.

    • Dimensions: 16.5 cm x 22.2 cm (6.5" x 8.75")
    • Cover printed in vibrant, sharp colour
    • 80 black & white lined pages
    • College ruled
    • Lay flat spiral binding
    This product is recommended for ages 8+..
    Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 16.5 cm x 22.2 cm (6.5" x 8.75"). For best results please add 0.3 cm (1/8") bleed..

    About This Design

    The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
    Daisy Chain - Notebook (Bright Pink)

    Daisy Chain - Notebook (Bright Pink)

    A modern take on a sweet floral motif, Daisy Chain feels both playful and refined. The repeating pattern brings movement and rhythm, while the high-contrast palette keeps it crisp and graphic. Designed with a Scandinavian sensibility—simple, bold, and intentional—this adds personality without feeling overdone. It’s the kind of piece that stands out on its own but still works effortlessly with everything else you carry. Lighthearted, modern, and a little unexpected—this is everyday design done right.

    Customer Reviews

    4.8 out of 5 stars rating1.8K Total Reviews
    1531 total 5-star reviews189 total 4-star reviews42 total 3-star reviews28 total 2-star reviews16 total 1-star reviews
    1,806 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By I.15 July 2015Verified Purchase
    16.51 cm x 22.22 cm Classic Notebook
    Zazzle Reviewer Program
    This arrived So Much faster than I was expecting. I left plenty of time for international shipping and then didn't need it. I wasn't sure how the image would turn out (have never bought a notebook from Zazzle before). I was pleasantly surprised by the quality of the image.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Mandy30 December 2017Verified Purchase
    16.51 cm x 22.22 cm Classic Notebook
    Creator Review
    Item was exactly as described. Very pleased. Print was excellent quality.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Robert K.18 May 2022Verified Purchase
    16.51 cm x 22.22 cm Classic Notebook
    Creator Review
    The image was bright and crisp - the details of the artwork came out perfectly. The paper is easy to write on. Perfect printing - better than expected!

    Tags

    Notebooks
    modernscandinavianartsyfloraldaisylacepinkgirlydelicatefeminine
    All Products
    modernscandinavianartsyfloraldaisylacepinkgirlydelicatefeminine

    Other Info

    Product ID: 256029940409343732
    Added on 27/3/26, 3:26 pm
    Rating: G