Tap / click on image to see more RealViewsTM
$84.90
per wallpaper
 

Cute Watercolor Baby Alligator Wallpaper

Qty:

Other designs from this category

About Wallpapers

Sold by

Style: Textured vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish embossed with a canvas texture and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colours to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.

About This Design

Cute Watercolor Baby Alligator Wallpaper

Cute Watercolor Baby Alligator Wallpaper

Cute Watercolor Baby Alligator

Customer Reviews

4.0 out of 5 stars rating6 Total Reviews
4 total 5-star reviews0 total 4-star reviews1 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
6 Reviews
Reviews for similar products
5 out of 5 stars rating
By Charles K.15 August 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
It is fabulous! Am always excited to show others. It is dramatic!!
from zazzle.com (US)
5 out of 5 stars rating
By Suzanne R.18 September 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
Great xxxxxxxccc. Yuyyyyyyyyyyyyyyyyyy.
from zazzle.com (US)
3 out of 5 stars rating
By Naomi J.3 July 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
Need a lot to complete a small space because the lobster is all have to line up perfectly from peace to peace. I’ve already spent $600 and I need to order two more rolls in order to cover a very small space the size of a closet. The product has nice quality however the price is a little unreasonable for the sizes that they offer. I still will have to buy three more rolls that will make this almost $1000 project.
from zazzle.com (US)

Tags

Wallpapers
cutewatercolorbabyalligatornurseryanimalkidswhimsicalreptilesafari
All Products
cutewatercolorbabyalligatornurseryanimalkidswhimsicalreptilesafari

Other Info

Product ID: 256916936970366572
Added on 28/7/24, 2:01 pm
Rating: G