Tap / click on image to see more RealViewsTM
Sale Price $3.34.  
Original Price $4.45 per card
You save 25%

Cute Girly Princess Crown Pink Photo Watercolor Invitation

Collection
Qty:
Choose Your Format
Squared
+$0.35
+$0.40
+$0.40
+$0.40
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.90
+$0.90
-$0.30

Other designs from this category

Shop this collection

Ioana Nedelcu
PRINCESS BIRTHDAYDesigned by Ioana Nedelcu
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from various curated paper types, shapes and sizes to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Envelopes included but can be removed if not needed
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Various curated paper types to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.16 cm bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Cute Girly Princess Crown Pink Photo Watercolor   Invitation

Cute Girly Princess Crown Pink Photo Watercolor Invitation

This cute modern Princess invitation is perfect for your daughter's royal birthday bash. This enchanting design features a delicate white crown motif and Cinderella's magical essence, set against a vibrant pink backdrop, exuding grace and sophistication. The minimalist crown adds a regal touch, accompanied by classic black and white text for clarity and style. Celebrate your little princess in a whimsical manner with this customisable invitation, where you can include her name in beautiful handwriting. Elevate the magic further by adding a customisable photo of your princess. Available in both print and digital download formats, it's the ultimate choice for a memorable celebration.

Customer Reviews

4.8 out of 5 stars rating70.5K Total Reviews
62343 total 5-star reviews5754 total 4-star reviews1068 total 3-star reviews506 total 2-star reviews824 total 1-star reviews
70,495 Reviews
Reviews for similar products
5 out of 5 stars rating
By Sue M.17 January 2025Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
My invites arrived on time and beautiful quality. Definitely was worried for my first order but will definitely order from Dazzle in the future.
5 out of 5 stars rating
By k.4 December 2017Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I customised and ordered 30 of these cards for my Mum, to be used as guest place cards on the birthday table at our local restaurant venue. The design caught my eye while I was perusing all the samples, and thought it was a great novel idea for my steam train enthusiast Dad. I chose the larger postcard sized one, as the font would be large for older eyes, and customised it keeping the Rail Ticket theme on the front, with venue address/date/time of party, and on the back I added another steam train and various 80 speed limit/rail signages. The trick is not to overdo it or it looks too busy. I also added at one end of the front side, a word of thanks from the birthday boy. Champagne Shimmer was chosen for the finish and it suited the card so well, as it gave an glimmer of elegance and richness, loved it. During the party, I had guests come up to me and say how much they liked this quirky card. My Mum was ecstatic (she is hard to please at the best of times) and my Dad liked them very much also. Upon leaving the party venue, I noticed that not one single card was left behind at our guest table.....so to me it spoke volumes, that the guests appreciated the cards enough to want to take them home as mementos. I couldn't have wished for a better place card for Dad's 80th birthday party. Thanks Zazzle! Very happy with the finished product. Design turned out well, front and back. I kept with original background and border colouring, which went extremely well with my choice of Champagne Shimmer for the finish. I kept to minimal colour pictures added on the back, they printed up very well. All crisp and clean. The cards looked a million dollars!
5 out of 5 stars rating
By Jackie E.2 October 2023Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Loves the fact that I could change the name on each invitation so that they are all personalised without me having to write on them. Colours and text are perfect

Tags

Invitations
watercolorgirly pinkprincess birthday partywhite and pinkcinderellafairytalemagical fairyroyal5th birthdayphoto
All Products
watercolorgirly pinkprincess birthday partywhite and pinkcinderellafairytalemagical fairyroyal5th birthdayphoto

Other Info

Product ID: 256411210124026350
Added on 24/3/24, 6:52 am
Rating: G