Tap / click on image to see more RealViewsTM
$6.05
per sticker
 

Cute adorable kawaii animals sticker set

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 7.62 cm x 7.62 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Cute adorable kawaii animals sticker set

Cute adorable kawaii animals sticker set

Cute adorable kawaii animals sticker set.

Customer Reviews

4.8 out of 5 stars rating60 Total Reviews
54 total 5-star reviews2 total 4-star reviews1 total 3-star reviews1 total 2-star reviews2 total 1-star reviews
60 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By C.1 March 2021Verified Purchase
15.24 cm x 15.24 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I'm super happy with this beautiful Owl Mandala transfer. It suits my car perfectly. If I could have bought a bigger one, I would've! High-quality printing and materials. I believe the transfer will be relatively weather-resistant. Only time will tell.
5.0 out of 5 stars rating
5 out of 5 stars rating
By L.15 March 2023Verified Purchase
10.16 cm x 10.16 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This sticker is so cute and can’t wait to show it off to the world. Fantastic not a mark
5.0 out of 5 stars rating
5 out of 5 stars rating
By D.29 September 2023Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Glossy clear
Zazzle Reviewer Program
First time shopping on Zazzle I'll def buy more on here ....I like it it's on a transparent background so it's nice. Printing turned out well would show up really well on a coloured background I used it for a glass bottle

Tags

All Products
cuteadorablecuddlykawaiianimalsstickerfriendsfamily

Other Info

Product ID: 256966428736239911
Added on 24/6/25, 12:53 pm
Rating: G