Tap / click on image to see more RealViewsTM
$285.00
per watch
 

Custom Elegant Blue Flower Watch

Qty:
Heads-up!
Sorry, this product is completely sold out.
Oversized Silver Bracelet
-$95.00
-$95.00
-$116.00
-$116.00
-$116.00

About Watches

Sold by

Style: Unisex Oversized Silver Bracelet Watch

Keep perfect time with a customisable Unisex Oversized Bracelet watch from eWatchFactory. Ready for your text, artwork, designs or photos you can make a great watch for yourself or create one as a gift!

  • Unisex wrist watch
  • Material:
    • Face: Stainless steel
    • Strap: Stainless steel
  • Dimensions:
    • Face: 3.1 cm diameter
    • Strap: 21.6 cm x 2.1 cm
    • Case: 4 cm diameter
    • Weight: 144.7 g
  • 3-hand analog Japan Quartz®
  • Full colour custom printing on face
  • Foldover clasp closure
  • Water Resistance: Up to 3 ATM (30 metres)
  • 1 year manufacturers limited warranty
  • Battery included
  • This product is recommended for ages 13+

About This Design

Custom Elegant Blue Flower Watch

Custom Elegant Blue Flower Watch

Our Custom Elegant Blue Hydrangea Watch is a timeless piece inspired by nature's enchanting beauty. Featuring a breathtaking blue hydrangea motif, this watch captures the essence of tranquillity and elegance.

Customer Reviews

4.6 out of 5 stars rating1.3K Total Reviews
1040 total 5-star reviews154 total 4-star reviews31 total 3-star reviews22 total 2-star reviews75 total 1-star reviews
1,322 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Juan C.18 November 2022Verified Purchase
Watch, Oversized Silver Bracelet
Zazzle Reviewer Program
Very happy and extremely satisfied with my purchase. It was a gift for my son for being added to the starting offense on his college football team! The printing exceeded my expectations.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By S.7 January 2019Verified Purchase
Watch, Black Vintage Leather
Zazzle Reviewer Program
This was a fantastic purchase I love it! I had to take the belt for resizing, would be nice if I could have been able to select a band size. Other than that, perfect! Perfect! Exactly what I asked for. My design was simple black and white, and it looks great! *Note that the pics still have the protective covering on the watches
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By James J.4 February 2024Verified Purchase
Watch, Oversized Two-Tone Bracelet
Zazzle Reviewer Program
Good quality and style. Very pleased overall. Thumbs up for sure. The photo on the face of the watch is clear and everyone fitted in. Nice job.
from zazzle.com (US)

Tags

Watches
elegantblue hydrangeablue flowercreate your ownnature beautyhydrangealoverblueloverminimalisticwatchsimplegifts for her
All Products
elegantblue hydrangeablue flowercreate your ownnature beautyhydrangealoverblueloverminimalisticwatchsimplegifts for her

Other Info

Product ID: 256284582577425447
Added on 14/8/24, 9:32 pm
Rating: G