Tap / click on image to see more RealViewsTM
$68.75
per cushion
 

Classic Plaid Tartan Pattern-Navy & White Cushion

Qty:
Throw Cushion 40.6 x 40.6 cm
+$12.70
+$34.00

About Cushions

Sold by

Size: Throw Cushion 40.6 x 40.6 cm

Accent your home with custom cushions from Zazzle and make yourself the envy of the neighbourhood. Made from high-quality Simplex knit fabric, these 100% polyester cushions are soft and wrinkle-free. The heavyweight stretch material provides beautiful colour definition for your design while also being the perfect complement to your sofa!

  • Dimensions: 40.6 cm x 40.6 cm (square)
  • Simplex knit fabric; 100% polyester; wrinkle-free
  • Hidden zip enclosure; synthetic-filled insert included
  • Machine washable
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 40.6 cm. For best results, please add 1.5 cm bleed.

About This Design

Classic Plaid Tartan Pattern-Navy & White Cushion

Classic Plaid Tartan Pattern-Navy & White Cushion

This throw pillow features a classic plaid tartan pattern with crisp, intersecting lines and perfectly balanced symmetry. The structured check design adds a timeless, heritage‑inspired touch that works beautifully in both modern and traditional interiors. Its versatile, repeating grid motif adapts effortlessly to any colour palette — from soft neutrals to bold, high‑contrast combinations — making it an easy accent for sofas, beds, chairs, or cosy reading nooks

Customer Reviews

4.8 out of 5 stars rating9.6K Total Reviews
8310 total 5-star reviews903 total 4-star reviews192 total 3-star reviews75 total 2-star reviews112 total 1-star reviews
9,592 Reviews
Reviews for similar products
5 out of 5 stars rating
By Fran A.23 April 2021Verified Purchase
Throw Pillow, Throw Cushion 40.6 x 40.6 cm
Zazzle Reviewer Program
The quality of the pillow was excellent! The photos are clear and I was delighted on how the cover turned out. Printing quality was excellent.
5 out of 5 stars rating
By Deborah E.5 August 2021Verified Purchase
Throw Pillow, Throw Cushion 40.6 x 40.6 cm
Creator Review
My package arrived and I was so excited to see how beautiful my cushion designs turned out to be I have had many customers admire & purchase them zazzle helped bring my idea to life !! The product is definitely 5 star rating. The printing turned out so much more than what I expected these cushion designs look just beautiful the presentation is perfect the printing is very professional definitely a 5 star rating
CushionOriginal product
5 out of 5 stars rating
By Gaylene A.12 June 2017Verified Purchase
Throw Pillow, Throw Cushion 40.6 x 40.6 cm
Zazzle Reviewer Program
I absolutely love this product. I turned out even better than I expected too. I bought this for my mother for Mother's Day and she really loves it, she shows it too everyone she can and they all love it as well and want to know where I bought it from. The design turned out perfect, the printing of the words is fantastic they were so clear and easy to read, the color was also nicer than I thought it would be plus the images are so clear to see. I myself can't seem to keep looking at it, it's just gorgeous I love it, it couldn't have turned out any better

Tags

Cushions
classicplaidthrowpillowtartanpatternpillowcovergeometriccheckpillowtimelessplaidhomedecormoderntraditionalpillowstructuredgridpatternversatilepatternpillowstatementplaidcushionsymmetricalcheckdesignnavywhiteplaidthrowpillow
All Products
classicplaidthrowpillowtartanpatternpillowcovergeometriccheckpillowtimelessplaidhomedecormoderntraditionalpillowstructuredgridpatternversatilepatternpillowstatementplaidcushionsymmetricalcheckdesignnavywhiteplaidthrowpillow

Other Info

Product ID: 256005583188580567
Added on 9/9/25, 4:48 am
Rating: G