Tap / click on image to see more RealViewsTM
$56.30
per All-Over Print Apron
 

Classic Plaid Tartan Pattern-Navy & White Apron

Qty:
Black
Medium
-$7.35
+$4.95

Other designs from this category

About All-Over Print Aprons

Sold by

Size: All-Over Print Apron, Medium 66.04 cm x 76.2 cm

Whether you are cooking at home, hosting a summer BBQ, or creating arts & crafts- do so in style with our fully customisable aprons! Made of a top quality polyester, our fully sublimation designs will definitely make a great impression on your guests. Available in 3 sizes for adults, young adults, children- basically everyone! Each size is adorned with a sublimated neck strap and adjustable waist string to ensure the best design results.

  • Dimensions: 76.2 cm length x 66.04 cm width
  • Waist String 87.63 cm
  • Material: 100% Polyester
  • Full Dye Sublimation
  • One Side Printing Available
  • Machine wash in cold water on gentle cycle with mild detergent. Do not bleach or iron. Line dry.

About This Design

Classic Plaid Tartan Pattern-Navy & White Apron

Classic Plaid Tartan Pattern-Navy & White Apron

This apron features a classic plaid tartan pattern with crisp, intersecting lines and perfectly balanced symmetry. The structured check design blends heritage charm with modern versatility, making it a stylish and functional choice for cooking, baking, crafting, or hosting. Its repeating grid motif adapts beautifully to any colour palette — from understated neutrals to bold, high‑contrast combinations — ensuring it complements a wide range of personal styles and kitchen décor

Customer Reviews

4.7 out of 5 stars rating698 Total Reviews
607 total 5-star reviews44 total 4-star reviews6 total 3-star reviews8 total 2-star reviews33 total 1-star reviews
698 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sue P.10 December 2021Verified Purchase
All-Over Print Apron, Medium
Zazzle Reviewer Program
The apron was exactly as described on the internet. It is well made with good quality fabric and the stitching has been well finished. The colours are exactly as shown on the internet and the monogram has been done perfectly.
5.0 out of 5 stars rating
5 out of 5 stars rating
By M.8 January 2024Verified Purchase
All-Over Print Apron, Medium
Zazzle Reviewer Program
Perfect size apron for my man to use in his shed. Design turned out exactly as requested. Thank you 😁. Fantastic and as designed
5.0 out of 5 stars rating
5 out of 5 stars rating
By Alexia B.23 July 2023Verified Purchase
All-Over Print Apron, Medium
Zazzle Reviewer Program
This personalised apron was perfect in every way. Durable cotton material, well made and classy type font and beautiful colours... Beautiful colours and high quality printing...

Tags

All-Over Print Aprons
classicplaidaprontartanpatternaprongeometriccheckaprontimelessplaidhomedecormoderntraditionalapronstructuredgridpatternversatilepatternapronstatementplaidapronsymmetricalcheckdesignnavywhiteplaidapron
All Products
classicplaidaprontartanpatternaprongeometriccheckaprontimelessplaidhomedecormoderntraditionalapronstructuredgridpatternversatilepatternapronstatementplaidapronsymmetricalcheckdesignnavywhiteplaidapron

Other Info

Product ID: 256584205329890234
Added on 12/9/25, 5:22 pm
Rating: G