Tap / click on image to see more RealViewsTM
$30.80
$3.85 per paper plate
 

Christmas Open House Paper Plates 9"

Qty:
Personalise this template
22.86 cm Round Paper Plate
-$0.55
-$0.55
-$1.05

Other designs from this category

About Paper Plates

Sold by

Size and Style: 22.86 cm Round Paper Plate

Throw a spectacular party with fully customisable paper plates to match your theme! Each set of paper plates is printed on durable paper stock and decorated with your custom designs or photos. These plates are perfect for serving dinner, appetizers, or salads. Order these with our paper napkins for a complete set of party tableware that your guests will love!

  • Dimensions: 22.8 cm diameter
  • FDA compliant for food contact safety
  • Great for serving dinners, lunches, appetizers, or salads
  • Printed in USA

About This Design

Christmas Open House Paper Plates 9"

Christmas Open House Paper Plates 9"

Welcome, guests to your holiday home with a custom made a paper plate. Personalise this plate with your own words.***This graphic design was created from public domain illustrations that were layered onto the plate.

Customer Reviews

4.6 out of 5 stars rating1.3K Total Reviews
1080 total 5-star reviews98 total 4-star reviews39 total 3-star reviews37 total 2-star reviews56 total 1-star reviews
1,310 Reviews
Reviews for similar products
5 out of 5 stars rating
By Christine L.6 December 2022Verified Purchase
Paper Plates, 17.78 cm Round Paper Plate
Zazzle Reviewer Program
I was very impressed the plates were Beautifully done and got exactly what i ordered. The family had a pre Christmas get together, where the children come to decorate the tree. Once done the food platters come out and so did the plates. they were an absolute hit with the family so much so that nobody wanted to eat off them🥰 they made for a good conversational piece around the table. I will certainly be purchasing more from Zazzle. Thankyou. Awesome printing. You did not disappoint. 👏
5 out of 5 stars rating
By Julie b.7 June 2025Verified Purchase
Paper Plates, 22.86 cm Round Paper Plate
Absolutely beautiful will order again for the next birthday Thankyiu .
5 out of 5 stars rating
By Ebru a.16 August 2023Verified Purchase
Paper Plates, 17.78 cm Round Paper Plate
Zazzle Reviewer Program
Amazing!!!! I love the design it’s perfect i teared up when I opened the package cant wait till my sons birthday party 🥳 best seller I definitely recommend and I’ll definitely be buying off her every year for any birthday i have coming up. Perfecttttttttt!!! Couldn’t be any happier

Tags

Paper Plates
holiday partyopen housesnowmanfamilyfriendschristmaspaper plate
All Products
holiday partyopen housesnowmanfamilyfriendschristmaspaper plate

Other Info

Product ID: 256495157307116895
Added on 20/6/17, 8:51 pm
Rating: G