Tap / click on image to see more RealViewsTM
$21.40
per sticker
 

Chicken decal

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Large 20.32 cm x 20.32 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 20.32 cm L x 21.59 cm H
  • Design Area: 20.32 cm L x 20.32 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Chicken decal

Chicken decal

CLUCK IT funny chicken sticker decal.

Customer Reviews

4.6 out of 5 stars rating39 Total Reviews
34 total 5-star reviews1 total 4-star reviews1 total 3-star reviews0 total 2-star reviews3 total 1-star reviews
39 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jessica L.23 May 2024Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
I looked at a few templates for creating my own and decided on this one as it was the clearest indication that 1. indeed the background would be removed (white) and 2. was water proof for car window or in my case motorcycle helmet. Turned out perfect, and they were easy to peel off. Ignore the little bumps in the photo as I had not smoothed it down when taking the pic yet
from zazzle.com (US)
5 out of 5 stars rating
By Kathryn T.19 July 2024Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
New Mexico, transplant, military brat, dandelion, and New Mexico. Zia symbol. Land of enchantment. Love this window sticker helps me pick out my car out of a bunch of other white cars! The quality of the stickers wonderful and came out just the way I wanted! Love it! Satisfied customer. .
from zazzle.com (US)
5 out of 5 stars rating
By Karen M.13 September 2023Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
Our organization, Ormond Scenic Loop and Trail, had these printed to cut apart and sell/give away at community events as car decals. They have been very well accepted and a good way to get our name out at a low cost. I'm happy with the quality and the designs have lasted well and resisted fading even on the back windshield of my car which sits outside with the hot Florida sun beating down on it. The printing was acceptable.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
chickenstickerfunnygraphicdecalfarmvinylwindshieldcountryhumour
All Products
chickenstickerfunnygraphicdecalfarmvinylwindshieldcountryhumour

Other Info

Product ID: 256206797036792002
Added on 29/6/23, 9:44 pm
Rating: G