Tap / click on image to see more RealViewsTM
$34.50
per shirt
 

Cherry Hearts Cute and Funny T-Shirt

Qty:
Basic T-Shirt
+$13.50
+$18.75
White
Classic Printing: No Underbase
Vivid Printing: White Underbase
+$8.50

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Cherry Hearts Cute and Funny  T-Shirt

Cherry Hearts Cute and Funny T-Shirt

Sweet, playful, and full of charm, this Cherry Hearts T‑shirt brings a fresh twist to classic Valentine style. Featuring a cute cherry motif paired with heart‑shaped accents, it’s perfect for anyone who loves fun, flirty designs with a touch of retro sweetness. Whether you’re dressing for Valentine’s Day, gifting someone special, or simply adding a little love‑themed flair to your everyday wardrobe, this tee delivers cheerful vibes and effortless style.

Customer Reviews

4.5 out of 5 stars rating15.2K Total Reviews
10761 total 5-star reviews2908 total 4-star reviews850 total 3-star reviews400 total 2-star reviews274 total 1-star reviews
15,193 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ritz M.14 December 2020Verified Purchase
Basic T-Shirt, White, Medium
Zazzle Reviewer Program
Love how the print turn out for an affordable price. My tshirt looks really good
5.0 out of 5 stars rating
5 out of 5 stars rating
By H.17 October 2021Verified Purchase
Basic T-Shirt, Black, Small
Zazzle Reviewer Program
Look i bought this t-shirt for my wifey in a small. Its was way to small, it must of been a small fit. I wrote to Zazzle and they fixed it immediately and I received a new T very promptly. My wife absolutely adores it and says it’s so very comfortable. 10/10 Thanks Zazzle. Excellent printing, excellent color Actually its a excellent T-Shirt . Im so glad a found Zazzle im very impressed
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.27 December 2020Verified Purchase
Basic T-Shirt, White, Large
Zazzle Reviewer Program
The Shirt says it all - it is exactly as I wanted it and I couldn't be happier. This is a 10 out of 10 shirt. Ticks all the boxes. Thank you again Zazzle. No issues with the printing. It was perfect

Tags

All Products
cherryheartfunkycutesweetvalentinegraphicflirtycherries

Other Info

Product ID: 256124709515819054
Added on 6/2/26, 12:27 pm
Rating: G