Tap / click on image to see more RealViewsTM
$2.05
per sheet
 

Cherry Bridal Shower Recipe Card

Collection
Qty:

Other designs from this category

Shop this collection

Katsiaryna Lukyanava
Love is Cherry Sweet Bridal ShowerDesigned by Katsiaryna Lukyanava
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Paper Sheets

Sold by

Size: 11.4 cm x 14.2 cm

A flat sheet of paper has unlimited possibilities; from leaflets to paper aeroplanes and everything in between, the world is your oyster! Go and conquer.

  • Dimensions: 11.4 cm L x 14.2 cm H (portrait); 14.2 cm L x 11.4 cm H (landscape)
  • High-quality, full-colour, full-bleed printing
  • Print on both sides
  • Add personal photos and text for no additional charge
  • Please note that envelopes are optional
  • 100% satisfaction guarantee
  • Let us print for you! Select your desired quantity for any project big or small

Paper Type: Basic Semi-Gloss

Bright, crisp, and versatile—our Semi-Gloss paper delivers vibrant color and a smooth, polished finish, making it an ideal choice for your lightweight projects .

  • Made in Italy, printed in the USA
  • 50% recycled content

About This Design

Cherry Bridal Shower Recipe Card

Cherry Bridal Shower Recipe Card

This item designed to evoke a sense of anticipation and excitement, making guests feel cherished and honoured to be part of such a special occasion. The whimsical cherry motif, paired with elegant watercolor artistry, creates a design that is as delightful and sweet as the love being celebrated. Each cherry is rendered with a soft touch, capturing the lush red of ripe fruit and paired with delicate green leaves that add a lively contrast. This watercolor cherry canvas adds depth and dimension, giving the items a hand-crafted feel that is both personal and unique. This item invites guests to step into a world of whimsical romance. Click on the “Customise it” button for further personalisation of this template. You will be able to modify the style, colours, and sizes. Matching items available.

Customer Reviews

4.3 out of 5 stars rating115 Total Reviews
85 total 5-star reviews9 total 4-star reviews6 total 3-star reviews6 total 2-star reviews9 total 1-star reviews
115 Reviews
Reviews for similar products
5 out of 5 stars rating
By S.10 January 2021Verified Purchase
Flat Paper Sheet, Size: 11.4 cm x 14.2 cm, Paper: Basic Semi-Gloss, Envelopes: No Envelopes
Zazzle Reviewer Program
The cards came out great and happy with the outcome. Arrived earlier then expected. The cards came out great and happy with the outcome. Arrived earlier then expected..
5 out of 5 stars rating
By Dawn B.8 September 2021Verified Purchase
Flat Paper Sheet, Size: 11.4 cm x 14.2 cm, Paper: Basic Semi-Gloss, Envelopes: No Envelopes
Zazzle Reviewer Program
Perfect addition to the wedding shower invites. Couldn't have been more pleased. Font was beautiful on the cards.
from zazzle.com (US)
5 out of 5 stars rating
By Anonymous21 January 2026Verified Purchase
Flat Paper Sheet, Size: 11.4 cm x 14.2 cm, Paper: Basic Semi-Gloss, Envelopes: No Envelopes
Every year in my Christmas card, I include a family recipe. This template made the process so easy! I placed the recipe on one side and then a family story surrounding that recipe. The print came through vibrant and clear. The card stock was just thick enough to prevent bleed through. And the order came super quick! Loved it!!
from zazzle.com (US)

Tags

Paper Sheets
recipe cardbridal showercherryrecipeskitchencalligraphyfruitminimalistwatercolorwedding shower
All Products
recipe cardbridal showercherryrecipeskitchencalligraphyfruitminimalistwatercolorwedding shower

Other Info

Product ID: 256238823566084360
Added on 7/7/24, 2:20 am
Rating: G