Tap / click on image to see more RealViewsTM
$31.55
per pack of 50
 

Cherries Business Cards

4.7 out of 5 stars rating
40897 Total Reviews
|
by
Qty:
Squared
+$8.65
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-$7.30
-$7.30
+$7.20
+$7.20
+$7.20
+$7.20
+$7.20
+$7.20
+$20.05

Other designs from this category

About Business Cards

Sold by

Size: American, 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm x 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Cherries Business Cards

Cherries Business Cards

designed by marlodeedesigns.com © 2004-2012 MarloDee Designs: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing. You may NOT use them to decorate your website with or create additional products for your business. You MUST contact me for details, information or requests to use images on your business cards. Purchasing business cards here does not give you automatic permissiion to use the image on other items - nor - does it give you exclusive rights or usage rights.

Customer Reviews

4.7 out of 5 stars rating40.9K Total Reviews
33842 total 5-star reviews3932 total 4-star reviews1108 total 3-star reviews736 total 2-star reviews1279 total 1-star reviews
40,897 Reviews
Reviews for similar products
4.0 out of 5 stars rating
4 out of 5 stars rating
By Elizabeth S.6 May 2024Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle provides a way to modify the card designs & that is very useful. My order arrived 2 weeks from tthe order date. The card looks great. I would have liked some more design options such as stock images, such as some wedding rings, which I would have liked to include on my business card. Packaging - one suggestion for improvement - post in a sturdy postal box. Mine were in a small box, inside a flat postal bag. During postage the box had been squashed & all my 100 cards were loose inside the postal bsg. Fortunately none were damaged. Looks great. Option to have raised letters would be a welcome additionsl option.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Diane B.19 March 2024Verified Purchase
Business Card, Size: Square, 64 mm x 64 mm,Paper: Signature Matte, Corners: Squared
I do love these square cards I had to redo them twice, yet wasn’t too happy as I had made the writing smaller on the back even though I thought I’d made it bigger. Yet they still great 😊 Still used them for my event. I could of designed the writing on the back better than I did it came out a little small yet still happy with them I still used them
5.0 out of 5 stars rating
5 out of 5 stars rating
By Wendy B.10 March 2024Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Signature Matte, Corners: Squared
I’ve purchased these a couple of times now as Thank you Cards and candle care instructions on the other side.and I’ll keep ordering them! The turnaround from ordering to delivery was extremely quick. My customers love the quality and size of these amazing cards so much that a lot of them ordered the cards themselves! Highly recommend! The printing of these cards are perfect! The print is very easy to read.

Tags

Business Cards
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness
All Products
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness

Other Info

Product ID: 240439096599212623
Added on 24/3/08, 5:47 pm
Rating: G