Tap / click on image to see more RealViewsTM
$31.25
per pack of 50
 

Cherries Business Cards

Qty:
Squared
+$10.40
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-$8.75
-$8.75
+$8.65
+$8.65

Other designs from this category

About Business Cards

Sold by

Size: American, 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm x 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Cherries Business Cards

Cherries Business Cards

designed by marlodeedesigns.com © 2004-2012 MarloDee Designs: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing. You may NOT use them to decorate your website with or create additional products for your business. You MUST contact me for details, information or requests to use images on your business cards. Purchasing business cards here does not give you automatic permissiion to use the image on other items - nor - does it give you exclusive rights or usage rights.

Customer Reviews

4.7 out of 5 stars rating39.9K Total Reviews
33186 total 5-star reviews3886 total 4-star reviews1050 total 3-star reviews673 total 2-star reviews1070 total 1-star reviews
39,865 Reviews
Reviews for similar products
4 out of 5 stars rating
By Elizabeth S.6 May 2024Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle provides a way to modify the card designs & that is very useful. My order arrived 2 weeks from tthe order date. The card looks great. I would have liked some more design options such as stock images, such as some wedding rings, which I would have liked to include on my business card. Packaging - one suggestion for improvement - post in a sturdy postal box. Mine were in a small box, inside a flat postal bag. During postage the box had been squashed & all my 100 cards were loose inside the postal bsg. Fortunately none were damaged. Looks great. Option to have raised letters would be a welcome additionsl option.
5 out of 5 stars rating
By Shauna Y.1 November 2021Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle Reviewer Program
This product was just what I was hoping for. It arrived faster than I expected and exceeded my expectations. The design turned out perfect and I was blown away with the quality and detail of the product. I have since bought 300 more.
5 out of 5 stars rating
By Ronnie A.5 January 2020Verified Purchase
Business Card, Size: Square, 64 mm x 64 mm,Paper: Signature UV Matte, Corners: Squared
Zazzle Reviewer Program
I ordered these cards as my business cards and I could not be happier. Beautiful quality card, clear writing and vibrant colours. I love the square size, they stand out as being different. They arrived a lot sooner than expected as well which was a pleasant surprise. Gorgeous vibrant colours, clear printing, I couldn't have asked for more.

Tags

Business Cards
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness
All Products
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness

Other Info

Product ID: 240439096599212623
Added on 24/3/08, 5:47 pm
Rating: G