Tap / click on image to see more RealViewsTM
$43.35
per roll
 

Charming Blush Pink Sweet Candy Cane Gift Wrapping Paper

Qty:

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Matte Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and five different sizes, our wrapping paper covers all your gift wrapping needs - because presentation matters as much as the gift!

  • 64lb print quality matte paper
  • Ideal for printing photos
  • Full colour edge-to-edge printing
  • Width: 74 cm
  • Length: multiple options from 1.8 m to 18.3 m
  • Each roll up to 4.6 m in length; lengths greater than 4.6 m shipped as multiple 4.6 m rolls
  • Length guide:
    • 1.8 m roll wraps 3 shirt-sized boxes
    • 4.6 m roll wraps 9 shirt-sized boxes
    • 9.1 m roll wraps 18 shirt-sized boxes
    • 13.7 m roll wraps 27 shirt-sized boxes
    • 18.3 m roll wraps 36 shirt-sized boxes
  • Designable area is 91 x 76 cm, but scaled down uniformly and printed at 88.4 x 73.7 cm
  • Please note: Designs are tiled after first 88.4 x 73.7 cm printed section

About This Design

Charming Blush Pink Sweet Candy Cane Gift  Wrapping Paper

Charming Blush Pink Sweet Candy Cane Gift Wrapping Paper

Wrap your gifts in the essence of holiday sweetness with our Charming Blush Pink Sweet Candy Cane Gift Wrap. Designed with a girlish charm, this wrapping paper features an adorable candy cane motif set against a delicate blush pink background, perfect for adding a dash of whimsy to your present presentation. The soft pink hues blend with the classic candy cane design to create a cute and inviting package, ideal for the holiday season. Whether it's for Christmas morning or a special winter celebration, this paper is sure to make your gifts stand out under the tree, delighting recipients of all ages with its delightful and playful pattern.

Customer Reviews

4.7 out of 5 stars rating4K Total Reviews
3373 total 5-star reviews381 total 4-star reviews111 total 3-star reviews69 total 2-star reviews83 total 1-star reviews
4,017 Reviews
Reviews for similar products
5 out of 5 stars rating
By Trish C.20 November 2020Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
I needed a vintage looking paper to line some draws of some furniture I upcycled and this gingham paper fit the bill perfectly. The paper was very easy to use and it turned out beautifully. The colour and quality was excellent.
5 out of 5 stars rating
By Siobhan S.31 October 2019Verified Purchase
Wrapping Paper, Glossy Wrapping Paper
Zazzle Reviewer Program
The colours are amazing I will definitely be buying this one again. Excellent.............................................
5 out of 5 stars rating
By Siobhan S.26 October 2019Verified Purchase
Wrapping Paper, Glossy Wrapping Paper
Zazzle Reviewer Program
Looks fantastic on furniture. Excellent....................................

Tags

Wrapping Paper
All Products
christmas wrapping papercandy canecutesimpleblush pinkgirlypinkpatternsweetfeminine

Other Info

Product ID: 256647581624454889
Added on 9/12/23, 6:11 am
Rating: G