Tap / click on image to see more RealViewsTM
$56.85
per hat
 

Cat Lover Embroidered Baseball Cap / Hat

Qty:
Distressed Adjustable Cap
-$2.10
-$8.35
Stone

Other designs from this category

About Embroidered Hats

Sold by

Style: Distressed Adjustable Cap

If you like the lived-in look, you'll love this enzyme-washed hat from District Threads. Comfortable as an old friend, it's 100% cotton and has an unstructured style with 6 panels and a low profile. Make it the perfect size with the metal D-ring slider buckle and hideaway cloth strap.

  • 100% cotton twill
  • Decoration style: digital embroidery
  • Low profile and unstructured
  • Metal D-ring slider buckle with hideaway strap closure
  • Due to a special finishing process, distress and colour may vary
  • Care instructions: machine wash cold, non-chlorine bleach when needed, tumble dry medium. Do not iron decorations or customisation

For some design guidance please see: How Do I Create a Design Suitable for Zazzle Embroidery

About This Design

Cat Lover Embroidered Baseball Cap / Hat

Cat Lover Embroidered Baseball Cap / Hat

For the cat lover

Customer Reviews

4.7 out of 5 stars rating1.2K Total Reviews
962 total 5-star reviews139 total 4-star reviews41 total 3-star reviews9 total 2-star reviews14 total 1-star reviews
1,165 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By A.25 October 2023Verified Purchase
Embroidered Hat, Basic Adjustable Cap
Zazzle Reviewer Program
Excellent workmanship
5.0 out of 5 stars rating
5 out of 5 stars rating
By M.8 January 2024Verified Purchase
Embroidered Hat, Distressed Adjustable Cap
Zazzle Reviewer Program
Thank you so much. This cap turned out so well and exactly as I had hoped. Very very happy and highly recommend! ❤️. Beautiful and as designed
5.0 out of 5 stars rating
5 out of 5 stars rating
By Innocent P.1 October 2021Verified Purchase
Embroidered Hat, Distressed Adjustable Cap
Zazzle Reviewer Program
It's super durable and the embroidery hasn't frayed or ripped at all! It's also adjustable in size! Super amazing. Hasn't come off or anything.
from zazzle.com (US)

Tags

Embroidered Hats
catcat hatkitty catcat loverveterinariankittyanimalpetfeline
All Products
catcat hatkitty catcat loverveterinariankittyanimalpetfeline

Other Info

Product ID: 233653693946551313
Added on 21/3/12, 8:32 am
Rating: G