Tap / click on image to see more RealViewsTM
$35.30
per hat
 

Caduceus Trucker Hat

Qty:
White and Black

Other designs from this category

About Hats

Sold by

Style: Foam Trucker Hat

Looking to cheer your team, promote your brand, or simply keep the sun out of your eyes? Our custom hats are the perfect way to meet all these needs and more. Customise the front with a logo, design, or text and create an essential accessory that you will never leave behind!

  • Adjustable from 43.18 cm to 60.96 cm
  • 100% polyester foam front
  • Wide area to feature your design
  • 100% nylon mesh back keeps you cool
  • Available in 11 colour combinations
Recommended for ages 13+

This product can expose you to chemicals including Diisononyl phthalate (DINP), which is known to the State of California to cause cancer / birth defects or other reproductive harm. For more information go to www.P65Warnings.ca.gov.

About This Design

Caduceus Trucker Hat

Caduceus Trucker Hat

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating2.4K Total Reviews
1948 total 5-star reviews330 total 4-star reviews65 total 3-star reviews18 total 2-star reviews24 total 1-star reviews
2,385 Reviews
Reviews for similar products
5 out of 5 stars rating
By Chantalle M.9 September 2023Verified Purchase
Trucker Hat, White and Black
Zazzle Reviewer Program
Nearly didn't recieve this on time for fathers day but luckily did. pretty happy with it, my son gave this to my partner for fathers day and my partner absolutely loves it. good quality and just like pictured.
5 out of 5 stars rating
By R.23 October 2014Verified Purchase
Trucker Hat, White and Black
Zazzle Reviewer Program
So happy with our hats!! Great printing! Defs worth it! 100% recommended :)
5 out of 5 stars rating
By Megan S.22 January 2023Verified Purchase
Trucker Hat, White and White
Zazzle Reviewer Program
I love this hat. The style and comfort it awesome. I really loved how quickly it arrived in time for me to promote my business. The printing was exactly what I wanted.

Tags

Hats
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 148478503511291049
Added on 26/4/10, 7:24 am
Rating: G