Tap / click on image to see more RealViewsTM
$50.50
per tie
 

Caduceus Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm
    • Width: 10.1 cm (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

Caduceus Tie

Caduceus Tie

Design that makes caduceus motif

Customer Reviews

4.5 out of 5 stars rating2.5K Total Reviews
1817 total 5-star reviews328 total 4-star reviews134 total 3-star reviews70 total 2-star reviews103 total 1-star reviews
2,452 Reviews
Reviews for similar products
5 out of 5 stars rating
By Amy C.17 May 2022Verified Purchase
Tie
Zazzle Reviewer Program
It's absolutely perfect!! Turned out much better then I expected ❤️ It is a little expensive but very worth it. Printing is perfect can read it very well
4 out of 5 stars rating
By Anonymous14 September 2025Verified Purchase
Tie
I originally ordered 1 tie to test and ensure I liked it with the suits we had ordered! The tie came and it was perfect! We loved it! The colours were bright and the tie was beautifully made. I then ordered the 6 additional ties and the colours are slightly different. The 6 ties were a little less vibrant and the white background was slightly different! .
5 out of 5 stars rating
By Anonymous6 April 2025Verified Purchase
Tie
Lovely. My English class was impressed!

Tags

Ties
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 151268738381438883
Added on 25/4/10, 1:10 pm
Rating: G