Tap / click on image to see more RealViewsTM
$62.80
per tie
 

Caduceus Tie

Qty:

    Other designs from this category

    About Ties

    Sold by

    Style: Tie

    Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

    • Dimensions:
      • Length: 139 cm
      • Width: 10.1 cm (at widest point)
    • Printed in vibrant full colour
    • Made from 100% polyester; silky finish
    • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
    • Dry clean only

    About This Design

    Caduceus Tie

    Caduceus Tie

    Design that makes caduceus motif

    Customer Reviews

    4.5 out of 5 stars rating2.5K Total Reviews
    1857 total 5-star reviews331 total 4-star reviews144 total 3-star reviews77 total 2-star reviews129 total 1-star reviews
    2,538 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Amy C.17 May 2022 • Verified Purchase
    Tie
    Zazzle Reviewer Program
    It's absolutely perfect!! Turned out much better then I expected ❤️ It is a little expensive but very worth it. Printing is perfect can read it very well
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Anonymous6 April 2025 • Verified Purchase
    Tie
    Lovely. My English class was impressed!
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Geoff T.25 January 2021 • Verified Purchase
    Tie
    Zazzle Reviewer Program
    Great company, gave me a generous credit when I made an ordering mistake. Delivery of products very quick. Highly recommended. Quality of the product is excellent

    Tags

    caduceusmedicalsymbolmedicinegreekphysicianswandhermes

    Other Info

    Product ID: 151268738381438883
    Added on 25/4/10, 1:10 pm
    Rating: G