Tap / click on image to see more RealViewsTM
$62.80
per tie
 

Caduceus Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm
    • Width: 10.1 cm (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

Caduceus Tie

Caduceus Tie

Design that makes caduceus motif

Customer Reviews

4.5 out of 5 stars rating2.5K Total Reviews
1849 total 5-star reviews331 total 4-star reviews142 total 3-star reviews75 total 2-star reviews125 total 1-star reviews
2,522 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Amy C.17 May 2022Verified Purchase
Tie
Zazzle Reviewer Program
It's absolutely perfect!! Turned out much better then I expected ❤️ It is a little expensive but very worth it. Printing is perfect can read it very well
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous6 April 2025Verified Purchase
Tie
Lovely. My English class was impressed!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Natalie-Ann G.15 July 2019Verified Purchase
Tie
Zazzle Reviewer Program
Thanks for delivering this wonderful tie for my best friends 40th 90s theme birthday party. My partner and I are dressing up as Mulder and Scully and the tie is very Mulderish. The character should have worn one in the show. Tie arrived quickly and everything went smoothly with the purchase. Would highly recommend Zazzle to other shoppers. 👽😃. Exactly like picture

Tags

Ties
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 151268738381438883
Added on 25/4/10, 1:10 pm
Rating: G