Tap / click on image to see more RealViewsTM
$77.85
per poster
 

Caduceus Poster

Qty:
Choose Your Format
Custom (43.31cm x 50.75cm)
None

Other designs from this category

About Posters

Sold by

Paper Type: Value Poster Paper (Semi-Gloss)

Your walls are a reflection of your personality, so let them speak with your favourite quotes, art, or designs printed on our custom Giclée posters! High-quality, microporous resin-coated paper with a beautiful semi-gloss finish. Choose from standard or custom-sized posters and framing options to create art that’s a perfect representation of you.

  • Gallery-quality Giclée prints
  • Ideal for vibrant artwork and photographic reproduction
  • Semi-gloss finish
  • Pigment-based inks for full-colour spectrum high-resolution printing
  • Durable 185gsm paper
  • Available in custom sizing up to 152.4 cm
  • Frames available on all standard sizes
  • Frames include Non-Glare Acrylic Glazing

About This Design

Caduceus Poster

Caduceus Poster

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating14.6K Total Reviews
12542 total 5-star reviews1369 total 4-star reviews269 total 3-star reviews155 total 2-star reviews294 total 1-star reviews
14,629 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jubelen P.27 February 2020Verified Purchase
Print, Size: 76.20cm x 50.80cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
my staff loves it , and other branch is asking me where i got this and i give your website to them. maybe you can add up on personalised option, laminated or a frame maybe . great job. but you can add an option if we wanted to have it laminated or frame as add up option
5 out of 5 stars rating
By Timothy G.14 October 2021Verified Purchase
Zazzle Reviewer Program
I hung this in the stairwell of our house, near some other Renoir pictures. My daughter says it looks like she is looking at her when she walks up the stairs. it's called "The Excursionist", she is holding a walking stick. Renoir was an impressionist, I don't think this is an actual person. The finished framed picture arrived and looks better than the online pic - Beautiful!
5 out of 5 stars rating
By Ross Y.31 December 2019Verified Purchase
Print, Size: 48.26cm x 33.02cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
Absolutely superb Art Deco poster. The colours are vibrant, sympathetic to the era and perfect for use. I framed it and hung above the entrance to my Art Deco inspired lounge room. Stunning! The print is precise, clear and of an excellent standard. It was cleverly packaged so there wasn’t a blemish or crease. Perfect!

Tags

Posters
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 228598453171099113
Added on 25/4/10, 1:20 pm
Rating: G