Tap / click on image to see more RealViewsTM
$17.30
per keychain
 

Caduceus Key Ring

Qty:
Aluminum Circle
+$4.55
+$4.55
+$22.20
+$22.20

Other designs from this category

About Keychains

About This Design

Caduceus Key Ring

Caduceus Key Ring

Design that makes caduceus motif

Customer Reviews

4.6 out of 5 stars rating5.6K Total Reviews
4354 total 5-star reviews802 total 4-star reviews223 total 3-star reviews120 total 2-star reviews106 total 1-star reviews
5,605 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By T.29 May 2025Verified Purchase
Metal Circle Keychain, 5.08 cm
A huge big THANK YOU to the designer Little Linda Pinda. This was a special order and it turned out so lovely. Very happy. And the delivery was super quick too.
5.0 out of 5 stars rating
5 out of 5 stars rating
By cindy t.8 November 2023Verified Purchase
Metal Circle Keychain, 5.08 cm
Zazzle Reviewer Program
Product quality is great, art work is perfect. Would highly recommend. Fast turn around, I was surprised they arrived so quickly, as I had a fairly large order. Perfect, centred and exactly what I wanted
5.0 out of 5 stars rating
5 out of 5 stars rating
By T.29 May 2025Verified Purchase
Metal Circle Keychain, 5.08 cm
A huge big THANK YOU to the designer Little Linda Pinda. This was a special order and it turned out so lovely. Very happy. And the delivery was super quick too.

Tags

Keychains
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 146613818880137283
Added on 25/4/10, 1:42 pm
Rating: G