Tap / click on image to see more RealViewsTM
Sale Price $9.83.  
Original Price $13.10 per sheet of 20
You save 25% ends today

Caduceus Classic Round Sticker

Qty:
Classic Round Stickers
+$0.55
+$0.55
+$0.55

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Caduceus Classic Round Sticker

Caduceus Classic Round Sticker

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating26.9K Total Reviews
23407 total 5-star reviews2233 total 4-star reviews519 total 3-star reviews294 total 2-star reviews457 total 1-star reviews
26,910 Reviews
Reviews for similar products
5 out of 5 stars rating
By C.18 July 2021Verified Purchase
Zazzle Reviewer Program
These stickers were perfect!! They turned out exactly how i planned. The quality is amazing, the wording and images were right - no fuzziness. Very very happy! Quality is amazing! Turned out better than expected
5 out of 5 stars rating
By Kara D.18 May 2019Verified Purchase
Zazzle Reviewer Program
Very good, perfectly good for the job we wanted. Very good - very happy with the final product.
5 out of 5 stars rating
By Charmaine S.6 April 2022Verified Purchase
Zazzle Reviewer Program
Overall very useful for my small business. Gives the final touch to my end products that I’m making. Will continue to use if the prices are reasonable. Excellent print, easy to read and looks great on the jars.

Tags

All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 217421214359186041
Added on 25/4/10, 1:28 pm
Rating: G