Tap / click on image to see more RealViewsTM
$13.10
per sheet of 20
 

Caduceus Classic Round Sticker

Qty:
Classic Round Stickers
+$0.55
+$0.55
+$0.55

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Caduceus Classic Round Sticker

Caduceus Classic Round Sticker

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating27.1K Total Reviews
23552 total 5-star reviews2240 total 4-star reviews538 total 3-star reviews314 total 2-star reviews487 total 1-star reviews
27,131 Reviews
Reviews for similar products
5 out of 5 stars rating
By C.18 July 2021Verified Purchase
Zazzle Reviewer Program
These stickers were perfect!! They turned out exactly how i planned. The quality is amazing, the wording and images were right - no fuzziness. Very very happy! Quality is amazing! Turned out better than expected
5 out of 5 stars rating
By Kara D.18 May 2019Verified Purchase
Zazzle Reviewer Program
Very good, perfectly good for the job we wanted. Very good - very happy with the final product.
5 out of 5 stars rating
By Aldo A.24 December 2023Verified Purchase
Zazzle Reviewer Program
Great customer service. After a long delay, I contacted Zazzle and they immediately declared the stickers were lost by the post. Another printout was created and expressed post at no cost to me. They came within a week in time for our first harvest. The stickers are exactly as ordered. They fit perfectly on my small honey jars. My daughter, Philippa is over the moon to see her name on the honey jars.

Tags

All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 217421214359186041
Added on 25/4/10, 1:28 pm
Rating: G