Tap / click on image to see more RealViewsTM
Sale Price $29.96.  
Original Price $37.45 per pack of 50
You save 20%

Caduceus Business Card

Qty:
  1. Size

  2. Corner Style

  3. Paper

Other designs from this category

About Business Cards

Sold by

Size: 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm × 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Caduceus Business Card

Caduceus Business Card

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating41.3K Total Reviews
34074 total 5-star reviews3954 total 4-star reviews1128 total 3-star reviews768 total 2-star reviews1354 total 1-star reviews
41,278 Reviews
5.0 out of 5 stars rating
5 out of 5 stars rating
By name7 April 2015 • Verified Purchase
Business Card, Size: 89 mm x 51 mm,Paper: Signature UV Matte, Corners: Squared
Zazzle Reviewer Program
Gold Business Cards Stand Out !!! Easy to locate among the others. printing is great!!!!
from zazzle.com (US)
Reviews for similar products
4.0 out of 5 stars rating
4 out of 5 stars rating
By Elizabeth S.6 May 2024 • Verified Purchase
Business Card, Size: 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle provides a way to modify the card designs & that is very useful. My order arrived 2 weeks from tthe order date. The card looks great. I would have liked some more design options such as stock images, such as some wedding rings, which I would have liked to include on my business card. Packaging - one suggestion for improvement - post in a sturdy postal box. Mine were in a small box, inside a flat postal bag. During postage the box had been squashed & all my 100 cards were loose inside the postal bsg. Fortunately none were damaged. Looks great. Option to have raised letters would be a welcome additionsl option.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Diane B.19 March 2024 • Verified Purchase
Business Card, Size: 64 mm x 64 mm,Paper: Signature Matte, Corners: Squared
I do love these square cards I had to redo them twice, yet wasn’t too happy as I had made the writing smaller on the back even though I thought I’d made it bigger. Yet they still great 😊 Still used them for my event. I could of designed the writing on the back better than I did it came out a little small yet still happy with them I still used them

Tags

caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 240912045309499135
Added on 25/4/10, 1:11 pm
Rating: G