Tap / click on image to see more RealViewsTM
$37.45
per pack of 50
 

Caduceus Business Card

Qty:
Squared
+$8.65
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-$8.65
-$8.65
+$8.55
+$8.55
+$8.55
+$8.55
+$8.55
+$8.55
+$23.80

Other designs from this category

About Business Cards

Sold by

Size: American, 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm x 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Caduceus Business Card

Caduceus Business Card

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating40.6K Total Reviews
33610 total 5-star reviews3917 total 4-star reviews1098 total 3-star reviews716 total 2-star reviews1219 total 1-star reviews
40,560 Reviews
Reviews for similar products
4.0 out of 5 stars rating
4 out of 5 stars rating
By Elizabeth S.6 May 2024Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle provides a way to modify the card designs & that is very useful. My order arrived 2 weeks from tthe order date. The card looks great. I would have liked some more design options such as stock images, such as some wedding rings, which I would have liked to include on my business card. Packaging - one suggestion for improvement - post in a sturdy postal box. Mine were in a small box, inside a flat postal bag. During postage the box had been squashed & all my 100 cards were loose inside the postal bsg. Fortunately none were damaged. Looks great. Option to have raised letters would be a welcome additionsl option.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Shauna Y.1 November 2021Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle Reviewer Program
This product was just what I was hoping for. It arrived faster than I expected and exceeded my expectations. The design turned out perfect and I was blown away with the quality and detail of the product. I have since bought 300 more.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Breearne P.20 August 2021Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
This product arrived fast, packaged with care and the quality of the product is amazing. Overall would definitely be buying from zazzle again and am so impressed with this product. Amazing, clear, good quality. Better than I expected!

Tags

Business Cards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 240319032431428244
Added on 25/4/10, 1:12 pm
Rating: G