Tap / click on image to see more RealViewsTM
$37.45
per pack of 50
 

Caduceus Business Card

Qty:
Squared
+$8.65
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-$8.65
-$8.65
+$8.55
+$8.55
+$8.55
+$8.55
+$8.55
+$8.55
+$23.80

Other designs from this category

About Business Cards

Sold by

Size: American, 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm x 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Caduceus Business Card

Caduceus Business Card

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating40.9K Total Reviews
33842 total 5-star reviews3932 total 4-star reviews1108 total 3-star reviews736 total 2-star reviews1279 total 1-star reviews
40,897 Reviews
Reviews for similar products
4.0 out of 5 stars rating
4 out of 5 stars rating
By Elizabeth S.6 May 2024Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle provides a way to modify the card designs & that is very useful. My order arrived 2 weeks from tthe order date. The card looks great. I would have liked some more design options such as stock images, such as some wedding rings, which I would have liked to include on my business card. Packaging - one suggestion for improvement - post in a sturdy postal box. Mine were in a small box, inside a flat postal bag. During postage the box had been squashed & all my 100 cards were loose inside the postal bsg. Fortunately none were damaged. Looks great. Option to have raised letters would be a welcome additionsl option.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Diane B.19 March 2024Verified Purchase
Business Card, Size: Square, 64 mm x 64 mm,Paper: Signature Matte, Corners: Squared
I do love these square cards I had to redo them twice, yet wasn’t too happy as I had made the writing smaller on the back even though I thought I’d made it bigger. Yet they still great 😊 Still used them for my event. I could of designed the writing on the back better than I did it came out a little small yet still happy with them I still used them
5.0 out of 5 stars rating
5 out of 5 stars rating
By Wendy B.10 March 2024Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Signature Matte, Corners: Squared
I’ve purchased these a couple of times now as Thank you Cards and candle care instructions on the other side.and I’ll keep ordering them! The turnaround from ordering to delivery was extremely quick. My customers love the quality and size of these amazing cards so much that a lot of them ordered the cards themselves! Highly recommend! The printing of these cards are perfect! The print is very easy to read.

Tags

Business Cards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 240254427775690494
Added on 25/4/10, 1:13 pm
Rating: G