Tap / click on image to see more RealViewsTM
$26.70
$4.45 per sheet of tissue paper
 

BlushVine-Minimalist Leaf Pattern Soft Pink White Tissue Paper

Qty:
  1. Size

  2. Style

Other designs from this category

About Tissue Paper

Sold by

Size: 25.4 cm x 35.56 cm

When you've gone through the trouble of finding the perfect present make sure it has the perfect presentation. Give your gifts a personal touch with custom tissue paper printed with your chosen artwork or text. Gift giving just went from fun to super-fun!

  • Dimensions: 25.4 cm L x 35.56 cm W
  • Full colour edge-to-edge print
  • 4535g paper is great for wrapping jewellery, small gifts and party favours
  • 8164g paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

BlushVine-Minimalist Leaf Pattern Soft Pink White Tissue Paper

BlushVine-Minimalist Leaf Pattern Soft Pink White Tissue Paper

Wrap your gifts with understated elegance using our BlushVine Tissue Paper. Featuring a seamless pattern of stylised leaves outlined in soft pink on a crisp white background, this design offers a clean, modern aesthetic with botanical charm. Perfect for weddings, baby showers, boutique packaging, or everyday gifting, the delicate leaf motif adds a refined touch to any presentation. Lightweight, versatile, and visually soothing—this tissue paper elevates your wrapping game with graceful simplicity.

Customer Reviews

4.8 out of 5 stars rating3.2K Total Reviews
2850 total 5-star reviews163 total 4-star reviews53 total 3-star reviews28 total 2-star reviews67 total 1-star reviews
3,161 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Irene I.31 December 2021Verified Purchase
Custom 26.6 g/m² Tissue, Size: 53.34 cm x 73.66 cm
Zazzle Reviewer Program
Unused bedroom fireplace inspired by Leonardo David is red chalk drawings. Absolutely so proud and the overall result total success Magical at night so warm and comforting. Slight differences in depth of colour between sheets but perfectly acceptable as it is bespoke printing.Thrilled.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Annie S.5 May 2021Verified Purchase
Custom 14.8 g/m² Tissue, Size: 25.4 cm x 35.56 cm
Zazzle Reviewer Program
Gorgeous full colour print tissue paper. Ordered the thinnest GSM available in order to decoupage on a bedside table. Turned our great. Vibrant, bright colours. Print is bright and vivid colour. No pixellation. Gorgeous!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sonya B.9 June 2025Verified Purchase
Custom 26.6 g/m² Tissue, Size: 53.34 cm x 73.66 cm
Stunning paper, perfect thickness for decoupage without wrinkling. Absolutely thrilled with my purchase. .

Tags

blushvinetissuepapersoftpinkleafpatternminimalistgiftwrapbotanicaltissuedesignwhitebackgroundwrappingelegantpackagingpapernatureinspiredtissuepaperverticalleafmotifmoderngiftwrapstyledelicateleafdesign

Other Info

Product ID: 256347280109911345
Added on 13/8/24, 3:47 am
Rating: G