Tap / click on image to see more RealViewsTM
Sale Price $3.05.  
Original Price $4.35 per card
You save 30%

Black White Simple Minimalist Elegant Wedding Invitation

Qty:
Choose Your Format
Squared
+$0.35
+$0.40
+$0.40
+$0.40
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.95
+$0.95
-$0.25

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from twelve unique paper types, two printing options, and six shape options to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Two printing options available: Standard and High-Definition
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.15 cmbleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Black White Simple Minimalist Elegant Wedding Invitation

Black White Simple Minimalist Elegant Wedding Invitation

Celebrate your love with this Modern Black & White Minimalist Wedding Invitation, combining sleek design with natural elegance. Featuring clean lines, a refined serif typeface, and a tasteful white leaf motif at the base, this invitation is ideal for contemporary couples who appreciate understated beauty. With a solid dark background and elegant white typography, the design is both modern and timeless. The minimalist border and leaf accent add a subtle organic touch—perfect for garden weddings, modern ceremonies, or eco-conscious celebrations.

Customer Reviews

4.8 out of 5 stars rating33K Total Reviews
29024 total 5-star reviews2912 total 4-star reviews511 total 3-star reviews234 total 2-star reviews301 total 1-star reviews
32,982 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jaids K.13 March 2020Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
It was better than I could’ve ever imagined and so easy to create! Why spend hundreds of dollars to get a invitation company to produce something you can do yourself! Better than I could’ve ever imagined!
4 out of 5 stars rating
By Paula m.18 February 2024Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Look, it was good price, good time till delivery, photo and ink quality look great but sad at the final outcome. I ordered a trial invitation and it looked really good and I was stoked so I ordered the real invitations (25 of them) and they weren't thr same quality as the original first order. The had weird ink spots on the white side- im guessing seeping ink from the photo on the other side. A little disappointing they weren't at the same standard as the first one I ordered.
5 out of 5 stars rating
By Manuella C.9 October 2019Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Absolutely perfect I like how I could arrange the template design easily. Very good quality and the paper is good quality also

Tags

All Products
minimalistcontemporaryelegantstylishsimplesleekchicfashionabletrendysophisticated

Other Info

Product ID: 256748467101373100
Added on 27/9/24, 8:23 am
Rating: G