Tap / click on image to see more RealViewsTM
Sale Price $3.27.  
Original Price $4.35 per card
You save 25%

Black White Simple Minimalist Elegant Wedding Invitation

Qty:
Choose Your Format
Squared
+$0.35
+$0.40
+$0.40
+$0.40
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.95
+$0.95
-$0.25

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from various curated paper types, shapes and sizes to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Envelopes included but can be removed if not needed
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Various curated paper types to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.16 cm bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Black White Simple Minimalist Elegant Wedding Invitation

Black White Simple Minimalist Elegant Wedding Invitation

Celebrate your love with this Modern Black & White Minimalist Wedding Invitation, combining sleek design with natural elegance. Featuring clean lines, a refined serif typeface, and a tasteful white leaf motif at the base, this invitation is ideal for contemporary couples who appreciate understated beauty. With a solid dark background and elegant white typography, the design is both modern and timeless. The minimalist border and leaf accent add a subtle organic touch—perfect for garden weddings, modern ceremonies, or eco-conscious celebrations.

Customer Reviews

4.8 out of 5 stars rating33.4K Total Reviews
29354 total 5-star reviews2929 total 4-star reviews538 total 3-star reviews248 total 2-star reviews352 total 1-star reviews
33,421 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jaids K.13 March 2020Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
It was better than I could’ve ever imagined and so easy to create! Why spend hundreds of dollars to get a invitation company to produce something you can do yourself! Better than I could’ve ever imagined!
4 out of 5 stars rating
By Paula m.18 February 2024Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Look, it was good price, good time till delivery, photo and ink quality look great but sad at the final outcome. I ordered a trial invitation and it looked really good and I was stoked so I ordered the real invitations (25 of them) and they weren't thr same quality as the original first order. The had weird ink spots on the white side- im guessing seeping ink from the photo on the other side. A little disappointing they weren't at the same standard as the first one I ordered.
5 out of 5 stars rating
By Manuella C.9 October 2019Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Absolutely perfect I like how I could arrange the template design easily. Very good quality and the paper is good quality also

Tags

All Products
minimalistcontemporaryelegantstylishsimplesleekchicfashionabletrendysophisticated

Other Info

Product ID: 256748467101373100
Added on 27/9/24, 8:23 am
Rating: G