Tap / click on image to see more RealViewsTM
$55.80
per tie
 

Birds of Patagonia Birds Wildlife Animals Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm
    • Width: 10.1 cm (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

Birds of Patagonia Birds Wildlife Animals Tie

Birds of Patagonia Birds Wildlife Animals Tie

Gorgeous collage of vintage fine art of some of the Birds of Patagonia on this Tie. Images are public domain due to expired copyright.

Customer Reviews

4.5 out of 5 stars rating2.4K Total Reviews
1811 total 5-star reviews327 total 4-star reviews132 total 3-star reviews67 total 2-star reviews103 total 1-star reviews
2,440 Reviews
Reviews for similar products
5 out of 5 stars rating
By Amy C.17 May 2022Verified Purchase
Tie
Zazzle Reviewer Program
It's absolutely perfect!! Turned out much better then I expected ❤️ It is a little expensive but very worth it. Printing is perfect can read it very well
4 out of 5 stars rating
By Anonymous14 September 2025Verified Purchase
Tie
I originally ordered 1 tie to test and ensure I liked it with the suits we had ordered! The tie came and it was perfect! We loved it! The colours were bright and the tie was beautifully made. I then ordered the 6 additional ties and the colours are slightly different. The 6 ties were a little less vibrant and the white background was slightly different! .
5 out of 5 stars rating
By Anonymous6 April 2025Verified Purchase
Tie
Lovely. My English class was impressed!

Tags

Ties
birdanimalwildlifetienecktiepatagoniawetlandsflamingoesduckspatagonia wildlife
All Products
birdanimalwildlifetienecktiepatagoniawetlandsflamingoesduckspatagonia wildlife

Other Info

Product ID: 151130513312386564
Added on 31/12/18, 8:02 am
Rating: G