Tap / click on image to see more RealViewsTM
Sale Price $3.11.  
Original Price $4.14 per card
You save 25%

Baby Girl Shower Invitation Coquette Bow Aesthetic

Qty:
Choose Your Format
Squared
+$0.35
+$0.40
+$0.40
+$0.40
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.91
+$0.91
-$0.24

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from various curated paper types, shapes and sizes to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Envelopes included but can be removed if not needed
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Various curated paper types to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.16 cm bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Baby Girl Shower Invitation Coquette Bow Aesthetic

Baby Girl Shower Invitation Coquette Bow Aesthetic

Celebrate your little one in style with this coquette-inspired baby shower invitation featuring soft shades of pink, a delicate lined background, and a charming bow design for that timeless feminine touch. Perfect for moms-to-be who love the romantic coquette aesthetic, this invitation blends elegance, sweetness, and modern charm. Whether you’re planning a classic pink baby shower, a girly tea party theme, or a stylish bow-inspired celebration, this design sets the tone for a beautiful gathering. The blush tones and dainty details make it a versatile choice for baby girls, while the pretty bow motif adds a touch of vintage-inspired grace.

Customer Reviews

4.8 out of 5 stars rating11.2K Total Reviews
10096 total 5-star reviews810 total 4-star reviews143 total 3-star reviews67 total 2-star reviews133 total 1-star reviews
11,249 Reviews
Reviews for similar products
5 out of 5 stars rating
By Marianne B.10 June 2018Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
These invites were done perfectly and professionally, was very pleased with the results and would recommend it to my family and friends. The printing came out to exactly how i ordered it, was good quality and easier to read.
5 out of 5 stars rating
By C T.20 August 2023Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
This invitation was perfect for my baby in bloom baby shower. It was so pretty and was good quality. The printing was smooth an looks really professional
5 out of 5 stars rating
By Esra K.7 June 2022Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Wow! They are so beautifully made, and received them 5 days after placing order. Fast delivery, very very happy with whole service. Thank you!! Amazing just as the image!!! Great quality.

Tags

Invitations
pinkbowcoquettebabyshowernewarrivaldaintyfemininevintage
All Products
pinkbowcoquettebabyshowernewarrivaldaintyfemininevintage

Other Info

Product ID: 256578938762529566
Added on 22/9/25, 11:50 am
Rating: G