Sell on Zazzle
Tap / click on image to see more RealViewsTM
$12.60
$4.20 per sheet of tissue paper
 

2022 Periwinkle Blue Damask Old World Tissue Paper

4.8 out of 5 stars rating
2908 Total Reviews |
by
Qty:
Heads-up!
Sorry, this product is completely sold out.

Other designs from this category

About Tissue Paper

Sold by
Tissue Paper
Create your own from scratch

Size: 25.4 cm x 35.56 cm

When you've gone through the trouble of finding the perfect present make sure it has the perfect presentation. Give your gifts a personal touch with custom tissue paper printed with your chosen artwork or text. Gift giving just went from fun to super-fun!

  • Dimensions: 25.4 cm L x 35.56 cm W
  • Full colour edge-to-edge print
  • 4535g paper is great for wrapping jewellery, small gifts and party favours
  • 8164g paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper Periwinkle Damask Old World Tissue Paper 2022 Periwinkle Damask Old World Tissue Paper Damask old world design, damask motif element created by Kristie Hubler, in the 2022 Colour of the Year periwinkle blue, with lighter tone / tint of periwinkle for a background colour. Similar design at https://www.zazzle.com/damask_old_world_cream_yellow_tablecloth-256334957129875231 with different colour damask repeat and background colour. Thank you! Kristie Hubler http://zazzle.com/store/fabricatedframes/products fabricatedframescom@gmail.com damask, "old world", pattern, Mediterranean, periwinkle, vintage, "gift wrap", "tissue paper", blue
FabricatedFrames
Pro
Artwork designed by
Deptford, NJ, United States
View their Store

Customer Reviews

4.8 out of 5 stars rating2.9K Total Reviews
2641 total 5-star reviews151 total 4-star reviews47 total 3-star reviews23 total 2-star reviews46 total 1-star reviews
2,908 Reviews
Reviews for similar products
5 out of 5 stars rating
By Irene I.31 December 2021 • Verified Purchase
Custom Tissue Paper - 27 gsm (18lb), Size: 53.34 cm x 73.66 cm
Zazzle Reviewer Program
Unused bedroom fireplace inspired by Leonardo David is red chalk drawings. Absolutely so proud and the overall result total success Magical at night so warm and comforting. Slight differences in depth of colour between sheets but perfectly acceptable as it is bespoke printing.Thrilled.
5 out of 5 stars rating
By Annie S.5 May 2021 • Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 25.4 cm x 35.56 cm
Zazzle Reviewer Program
Gorgeous full colour print tissue paper. Ordered the thinnest GSM available in order to decoupage on a bedside table. Turned our great. Vibrant, bright colours. Print is bright and vivid colour. No pixellation. Gorgeous!
4 out of 5 stars rating
By Denise P.28 March 2021 • Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 45.72 cm x 60.96 cm
Zazzle Reviewer Program
Tissue paper is fantastic for creative projects such as collage, decoupage and mixed media. The designs are appealing. The colour and quality of paper are acceptable.

Tags

Tissue Paper
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022
All Products
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022

Other Info

Product ID: 256705250458015326
Added on 18/1/22, 8:27 pm
Rating: G